Detail information of JCDBG00002

JCDBG00002
ID
JCDBG00002
Name
psbA
Type
protein_coding
Scaffold
NC_012224.1
Start
499
End
1560
Strand
-
Link
Genbank id:7564824 | Jatropha Genome Database ID:Jcr4S09358.10
Molecular function
GO:0009055 | electron carrier activity
GO:0045156 | electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
Cellular component
Biological process
GO:0009772 | photosynthetic electron transport in photosystem II
GO:0019684 | photosynthesis, light reaction
KEGG
Entry: K02703
Name: psbA
Definition: photosystem II P680 reaction center D1 protein [EC:1.10.3.9]
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
CATGACTGCAATTTTAGAGAGACGCGAAAGCGAAAGCCTATGGGGTCGTTTCTGTAACTGGATAACCAGCACTGAAAACC GTCTTTACATTGGATGGTTTGGTGTTTTGATGATCCCTACTTTATTGACCGCAACTTCTGTATTTATTATCGCTTTCATT GCTGCACCTCCGGTAGATATTGATGGTATTCGTGAACCTGTTTCTGGGTCTCTACTTTATGGAAACAATATTATTTCTGG TGCCATTATTCCTACTTCTGCGGCTATAGGTTTGCATTTTTACCCAATATGGGAAGCGGCATCCGTTGATGAATGGTTAT ACAATGGCGGTCCTTATGAGCTAATTGTTCTACATTTCTTACTTGGTGTAGCTTGTTACATGGGTCGTGAGTGGGAACTT AGTTTCCGTCTGGGTATGCGCCCTTGGATTGCTGTTGCATATTCAGCTCCTGTTGCAGCTGCTACTGCTGTTTTCTTGAT CTATCCAATTGGTCAAGGAAGCTTTTCTGATGGTATGCCTCTAGGAATCTCTGGTACTTTCAACTTTATGATTGTATTCC AGGCTGAGCACAACATCCTTATGCACCCATTTCACATGTTAGGCGTAGCTGGTGTATTCGGCGGTTCCCTATTCAGTGCT ATGCATGGTTCCTTGGTAACCTCTAGTTTGATCAGGGAAACCACAGAAAATGAATCTGCTAATGAAGGTTACAGATTCGG TCAAGAGGAAGAAACTTATAATATCGTAGCCGCTCATGGTTATTTTGGCCGATTGATCTTCCAATATGCTAGTTTCAACA ATTCTCGTTCTTTACATTTCTTCTTAGCTGCTTGGCCTGTAGTAGGTATTTGGTTCACTGCTTTAGGTATTAGCACTATG GCTTTCAACCTAAATGGTTTCAATTTCAACCAATCCGTAGTTGATAGTCAAGGTCGTGTAATTAATACCTGGGCTGATAT TATTAACCGTGCTAACCTTGGTATGGAAGTTATGCATGAACGTAATGCTCATAACTTCCCTCTAGACCTAGCTGCTATTG AAGCTCCATCTACAAATGGATA
Gene structure

JCDB Genes gff download

JCDBG00002 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00002's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00002JCDBG00026co-exp0.926188
JCDBG00002JCDBG00027co-exp0.921385
JCDBG00002JCDBG00033co-exp0.899406
JCDBG00002JCDBG00071co-exp0.893332
JCDBG00002JCDBG00047co-exp0.867959
JCDBG00002JCDBG21578co-exp0.862277
JCDBG00002JCDBG00067co-exp0.859833
JCDBG00002JCDBG00048co-exp0.845832
JCDBG00002JCDBG13368co-exp0.841511
JCDBG00002JCDBG06926co-exp0.835296
JCDBG00026JCDBG00027co-exp0.967986
JCDBG00026JCDBG00033co-exp0.950075
JCDBG00026JCDBG00071co-exp0.934561
JCDBG00026JCDBG00047co-exp0.916383
JCDBG00026JCDBG21578co-exp0.810585
JCDBG00026JCDBG00067co-exp0.902249
JCDBG00026JCDBG00048co-exp0.835686
JCDBG00026JCDBG13368co-exp0.794893
JCDBG00026JCDBG06926co-exp0.73798
JCDBG00027JCDBG00033co-exp0.935167
JCDBG00027JCDBG00071co-exp0.925427
JCDBG00027JCDBG00047co-exp0.913089
JCDBG00027JCDBG21578co-exp0.839426
JCDBG00027JCDBG00067co-exp0.928913
JCDBG00027JCDBG00048co-exp0.818448
JCDBG00027JCDBG13368co-exp0.818329
JCDBG00027JCDBG06926co-exp0.790249
JCDBG00033JCDBG00071co-exp0.899852
JCDBG00033JCDBG00047co-exp0.885043
JCDBG00033JCDBG21578co-exp0.808187
JCDBG00033JCDBG00067co-exp0.87946
JCDBG00033JCDBG00048co-exp0.814849
JCDBG00033JCDBG13368co-exp0.807155
JCDBG00033JCDBG06926co-exp0.777456
JCDBG00071JCDBG00047co-exp0.937953
JCDBG00071JCDBG21578co-exp0.745523
JCDBG00071JCDBG00067co-exp0.921919
JCDBG00071JCDBG00048co-exp0.8096
JCDBG00071JCDBG13368co-exp0.753928
JCDBG00071JCDBG06926co-exp0.708841
JCDBG00047JCDBG21578co-exp0.742162
JCDBG00047JCDBG00067co-exp0.923353
JCDBG00047JCDBG00048co-exp0.772043
JCDBG00047JCDBG13368co-exp0.727017
JCDBG00047JCDBG06926co-exp0.672293
JCDBG21578JCDBG00067co-exp0.745601
JCDBG21578JCDBG00048co-exp0.7407
JCDBG21578JCDBG13368co-exp0.879288
JCDBG21578JCDBG06926co-exp0.823498
JCDBG00067JCDBG00048co-exp0.722515
JCDBG00067JCDBG13368co-exp0.782545
JCDBG00067JCDBG06926co-exp0.758191
JCDBG00048JCDBG13368co-exp0.711032
JCDBG00048JCDBG06926co-exp0.696487
JCDBG13368JCDBG06926co-exp0.88072
PPI network
node1node2type
JCDBG00002JCDBG03287PPI
JCDBG00002JCDBG17367PPI
JCDBR00002
ID
JCDBR00002
Name
psbA
Type
protein_coding
Scaffold
NC_012224.1
Start
499
End
1560
Strand
-
Exon
499-1560
Sequence
CATGACTGCAATTTTAGAGAGACGCGAAAGCGAAAGCCTATGGGGTCGTTTCTGTAACTGGATAACCAGCACTGAAAACC GTCTTTACATTGGATGGTTTGGTGTTTTGATGATCCCTACTTTATTGACCGCAACTTCTGTATTTATTATCGCTTTCATT GCTGCACCTCCGGTAGATATTGATGGTATTCGTGAACCTGTTTCTGGGTCTCTACTTTATGGAAACAATATTATTTCTGG TGCCATTATTCCTACTTCTGCGGCTATAGGTTTGCATTTTTACCCAATATGGGAAGCGGCATCCGTTGATGAATGGTTAT ACAATGGCGGTCCTTATGAGCTAATTGTTCTACATTTCTTACTTGGTGTAGCTTGTTACATGGGTCGTGAGTGGGAACTT AGTTTCCGTCTGGGTATGCGCCCTTGGATTGCTGTTGCATATTCAGCTCCTGTTGCAGCTGCTACTGCTGTTTTCTTGAT CTATCCAATTGGTCAAGGAAGCTTTTCTGATGGTATGCCTCTAGGAATCTCTGGTACTTTCAACTTTATGATTGTATTCC AGGCTGAGCACAACATCCTTATGCACCCATTTCACATGTTAGGCGTAGCTGGTGTATTCGGCGGTTCCCTATTCAGTGCT ATGCATGGTTCCTTGGTAACCTCTAGTTTGATCAGGGAAACCACAGAAAATGAATCTGCTAATGAAGGTTACAGATTCGG TCAAGAGGAAGAAACTTATAATATCGTAGCCGCTCATGGTTATTTTGGCCGATTGATCTTCCAATATGCTAGTTTCAACA ATTCTCGTTCTTTACATTTCTTCTTAGCTGCTTGGCCTGTAGTAGGTATTTGGTTCACTGCTTTAGGTATTAGCACTATG GCTTTCAACCTAAATGGTTTCAATTTCAACCAATCCGTAGTTGATAGTCAAGGTCGTGTAATTAATACCTGGGCTGATAT TATTAACCGTGCTAACCTTGGTATGGAAGTTATGCATGAACGTAATGCTCATAACTTCCCTCTAGACCTAGCTGCTATTG AAGCTCCATCTACAAATGGATA
Product
Source
RefSeq
Link:
JCDBP00001
ID
JCDBP00001
Parent
JCDBR00002
Name
YP_002720093.1
Scaffold
NC_012224.1
CDS
499-1560
Strand:
-
Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISG AIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLI YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADI INRANLGMEVMHERNAHNFPLDLAAIEAPSTNG
Product
photosystem II protein D1
Source
RefSeq
Link
YP_002720093.1
InterProScan
IPR000484 Photosynthetic reaction centre, L/M
IPR005867 Photosystem II protein D1
Pfam
PF00124.15 Photo_RC Family