Detail information of JCDBG00004

JCDBG00004
ID
JCDBG00004
Name
matK
Type
protein_coding
Scaffold
NC_012224.1
Start
2287
End
3816
Strand
-
Link
Genbank id:7564826
Molecular function
Cellular component
GO:0009507 | chloroplast
Biological process
GO:0006397 | mRNA processing
KEGG
Entry: K20000
Name: matK
Definition: maturase K
Source
RefSeq
TF
Description
Sequence
CATGTGGAAATATCAAAGATATTTAGAACTAGATGGATCTCGAAAAAATGACCTCCTATACCCATTTATCTTTCGGGAGT ATATTTATATATTTGCTCATGATCATAGTTTAAATAGATCGATTTTGTTGGAAAATGTAGGTTATGACAATAAATCTAGT TTCTTAATTGTAAAACGTTTAATTACTCGAATGTATCAACAGAATCGTTTGGTTTTTTTTTCTTTTTCTGCTAATGATTC TAACCAAAATTCATTTTTTAAGTACAACAAGAATTTGTATTATCAAATGATATCAGAGAGCTTTGCAGTTATTGTGGAAA TTCCATTTTCTCTACGGTTAGTATCTTCTTTAGAAAGGTCGGAGATAGTTAAATCTCATAAATTACGATCAATTCATTCA ATATTTCCTTTTTTAGAGGACAAATTTCCACATTTAATTTATGTGTCAGATGTATTAATACCTTACCCCATCCATATAGA AAAATTAGTCCAAACCCTTCGCTATTGGATGAAAGATCCCTCTTCTTTGCATTTATTACGACTCTTTCTTCATGAATATT GGAATAGGAACAGTCTTATTATTCAAAAGGGATCTATTTCTATTTTTACAAAAAGTAATCCAAGATTTTTCTTGTTCCTA TATAATTCTCATGTATATGAATACGAATCAATCCTCTTTTTTCTTCGTAACCAATCCTTTCATTTACGATCAACATTTTC TCGAGTCCTTCTTGAACGAATTTATTTCTATGGAAAAATAGAACATTTTGCAGAAGTCTTTGCTAATGATTTTCAGACTA TCCTATGGTTGGTCAAGTATCCTTTCATGCATTATGTTAGATATCAAGGAAAATCCATTCTGGCTTCAAAAGATGGGCCT CTTCTGATGAAAAAATGGAAATATTACCTTGTCAATTTATGTCAATGTCATTTTTATGTGTGGTTTCAACCAGAAAAGAT CTATATAAATTCATTATCCAAGCATTCTCTCAACCTTTTGGGCTATCTTTCAAATGTAAAATTAAATCCTTCGGTCGTAC GAAGTCAAATGCTAGAAAATTCATTTCTAATAGATAAAGATAATACTATGAAGAAACTCGATACAATAGTTCCAATTATT CCTTTGATTGGATCATTGTCAAAAACGAAATTTTGTAAGGCAGTAGGACATCCCATTAGTAAACCGGTCCGGACTGATTC ATCGGATTCTGATATTATCGACCGATTTGTGTGTATATGCAGAAATCTTTCTCATTATTATAGTGGATCTTCAATAAAAA AGAGTTTGTATCGAGTAAAATATATACTTCGACTTTCTTGTGTTAAAACTTTGATTCGTAAACACAAAAGTACTGTACGC GCTTTTTTGAAAAGATTGGGTTCGGAATTATTAGAAGAATTTTTTACAGAAGAAGAACAAACTCTTTCTTTGATCTTCCC GAGAGTTTCCTCTATTTCGCGCAGGTTATATAGGGGGCGGGTTTGGTATTTGGATATTATTTCTATCAATGATTTGGCCA ATCATGAATA
Gene structure

JCDB Genes gff download

JCDBG00004 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00004's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00004JCDBG00100co-exp0.845048
JCDBG00004JCDBG00047co-exp0.839702
JCDBG00004JCDBG00072co-exp0.826225
JCDBG00004JCDBG00042co-exp0.814407
JCDBG00004JCDBG00071co-exp0.805613
JCDBG00004JCDBG00018co-exp0.798679
JCDBG00004JCDBG00041co-exp0.779883
JCDBG00004JCDBG13616co-exp0.776158
JCDBG00004JCDBG00026co-exp0.772613
JCDBG00004JCDBG00067co-exp0.759114
JCDBG00100JCDBG00047co-exp0.821621
JCDBG00100JCDBG00072co-exp0.887318
JCDBG00100JCDBG00042co-exp0.91609
JCDBG00100JCDBG00071co-exp0.775348
JCDBG00100JCDBG00018co-exp0.814589
JCDBG00100JCDBG00041co-exp0.801022
JCDBG00100JCDBG13616co-exp0.748904
JCDBG00100JCDBG00026co-exp0.716613
JCDBG00100JCDBG00067co-exp0.81633
JCDBG00047JCDBG00072co-exp0.861011
JCDBG00047JCDBG00042co-exp0.899261
JCDBG00047JCDBG00071co-exp0.937953
JCDBG00047JCDBG00018co-exp0.766866
JCDBG00047JCDBG00041co-exp0.681668
JCDBG00047JCDBG13616co-exp0.681983
JCDBG00047JCDBG00026co-exp0.916383
JCDBG00047JCDBG00067co-exp0.923353
JCDBG00072JCDBG00042co-exp0.888954
JCDBG00072JCDBG00071co-exp0.850068
JCDBG00072JCDBG00018co-exp0.789748
JCDBG00072JCDBG00041co-exp0.831358
JCDBG00072JCDBG13616co-exp0.748836
JCDBG00072JCDBG00026co-exp0.818663
JCDBG00072JCDBG00067co-exp0.876583
JCDBG00042JCDBG00071co-exp0.860909
JCDBG00042JCDBG00018co-exp0.786843
JCDBG00042JCDBG00041co-exp0.747617
JCDBG00042JCDBG13616co-exp0.688404
JCDBG00042JCDBG00026co-exp0.811813
JCDBG00042JCDBG00067co-exp0.900122
JCDBG00071JCDBG00018co-exp0.731125
JCDBG00071JCDBG00041co-exp0.62637
JCDBG00071JCDBG13616co-exp0.613272
JCDBG00071JCDBG00026co-exp0.934561
JCDBG00071JCDBG00067co-exp0.921919
JCDBG00018JCDBG00041co-exp0.845236
JCDBG00018JCDBG00026co-exp0.699529
JCDBG00018JCDBG00067co-exp0.675611
JCDBG00041JCDBG13616co-exp0.731458
JCDBG00041JCDBG00026co-exp0.622927
JCDBG00041JCDBG00067co-exp0.662484
JCDBG13616JCDBG00067co-exp0.690241
JCDBG00026JCDBG00067co-exp0.902249
PPI network
node1node2type
JCDBR00004
ID
JCDBR00004
Name
matK
Type
protein_coding
Scaffold
NC_012224.1
Start
2287
End
3816
Strand
-
Exon
2287-3816
Sequence
CATGTGGAAATATCAAAGATATTTAGAACTAGATGGATCTCGAAAAAATGACCTCCTATACCCATTTATCTTTCGGGAGT ATATTTATATATTTGCTCATGATCATAGTTTAAATAGATCGATTTTGTTGGAAAATGTAGGTTATGACAATAAATCTAGT TTCTTAATTGTAAAACGTTTAATTACTCGAATGTATCAACAGAATCGTTTGGTTTTTTTTTCTTTTTCTGCTAATGATTC TAACCAAAATTCATTTTTTAAGTACAACAAGAATTTGTATTATCAAATGATATCAGAGAGCTTTGCAGTTATTGTGGAAA TTCCATTTTCTCTACGGTTAGTATCTTCTTTAGAAAGGTCGGAGATAGTTAAATCTCATAAATTACGATCAATTCATTCA ATATTTCCTTTTTTAGAGGACAAATTTCCACATTTAATTTATGTGTCAGATGTATTAATACCTTACCCCATCCATATAGA AAAATTAGTCCAAACCCTTCGCTATTGGATGAAAGATCCCTCTTCTTTGCATTTATTACGACTCTTTCTTCATGAATATT GGAATAGGAACAGTCTTATTATTCAAAAGGGATCTATTTCTATTTTTACAAAAAGTAATCCAAGATTTTTCTTGTTCCTA TATAATTCTCATGTATATGAATACGAATCAATCCTCTTTTTTCTTCGTAACCAATCCTTTCATTTACGATCAACATTTTC TCGAGTCCTTCTTGAACGAATTTATTTCTATGGAAAAATAGAACATTTTGCAGAAGTCTTTGCTAATGATTTTCAGACTA TCCTATGGTTGGTCAAGTATCCTTTCATGCATTATGTTAGATATCAAGGAAAATCCATTCTGGCTTCAAAAGATGGGCCT CTTCTGATGAAAAAATGGAAATATTACCTTGTCAATTTATGTCAATGTCATTTTTATGTGTGGTTTCAACCAGAAAAGAT CTATATAAATTCATTATCCAAGCATTCTCTCAACCTTTTGGGCTATCTTTCAAATGTAAAATTAAATCCTTCGGTCGTAC GAAGTCAAATGCTAGAAAATTCATTTCTAATAGATAAAGATAATACTATGAAGAAACTCGATACAATAGTTCCAATTATT CCTTTGATTGGATCATTGTCAAAAACGAAATTTTGTAAGGCAGTAGGACATCCCATTAGTAAACCGGTCCGGACTGATTC ATCGGATTCTGATATTATCGACCGATTTGTGTGTATATGCAGAAATCTTTCTCATTATTATAGTGGATCTTCAATAAAAA AGAGTTTGTATCGAGTAAAATATATACTTCGACTTTCTTGTGTTAAAACTTTGATTCGTAAACACAAAAGTACTGTACGC GCTTTTTTGAAAAGATTGGGTTCGGAATTATTAGAAGAATTTTTTACAGAAGAAGAACAAACTCTTTCTTTGATCTTCCC GAGAGTTTCCTCTATTTCGCGCAGGTTATATAGGGGGCGGGTTTGGTATTTGGATATTATTTCTATCAATGATTTGGCCA ATCATGAATA
Product
Source
RefSeq
Link:
JCDBP00002
ID
JCDBP00002
Parent
JCDBR00004
Name
YP_002720094.1
Scaffold
NC_012224.1
CDS
2287-3816
Strand:
-
Sequence
MWKYQRYLELDGSRKNDLLYPFIFREYIYIFAHDHSLNRSILLENVGYDNKSSFLIVKRLITRMYQQNRLVFFSFSANDS NQNSFFKYNKNLYYQMISESFAVIVEIPFSLRLVSSLERSEIVKSHKLRSIHSIFPFLEDKFPHLIYVSDVLIPYPIHIE KLVQTLRYWMKDPSSLHLLRLFLHEYWNRNSLIIQKGSISIFTKSNPRFFLFLYNSHVYEYESILFFLRNQSFHLRSTFS RVLLERIYFYGKIEHFAEVFANDFQTILWLVKYPFMHYVRYQGKSILASKDGPLLMKKWKYYLVNLCQCHFYVWFQPEKI YINSLSKHSLNLLGYLSNVKLNPSVVRSQMLENSFLIDKDNTMKKLDTIVPIIPLIGSLSKTKFCKAVGHPISKPVRTDS SDSDIIDRFVCICRNLSHYYSGSSIKKSLYRVKYILRLSCVKTLIRKHKSTVRAFLKRLGSELLEEFFTEEEQTLSLIFP RVSSISRRLYRGRVWYLDIISINDLANHE
Product
maturase K
Source
RefSeq
Link
YP_002720094.1
InterProScan
IPR002866 Maturase MatK
IPR024937 Domain X
IPR024942 Maturase MatK, N-terminal domain
Pfam
PF01824.14 MatK_N Family
PF01348.17 Intron_maturas2 Family