Detail information of JCDBG00006

JCDBG00006
ID
JCDBG00006
Name
psbK
Type
protein_coding
Scaffold
NC_012224.1
Start
6684
End
6878
Strand
+
Link
Genbank id:7564828
Molecular function
Cellular component
GO:0009539 | photosystem II reaction center
GO:0009523 | photosystem II
Biological process
GO:0015979 | photosynthesis
KEGG
Entry: K02712
Name: psbK
Definition: photosystem II PsbK protein
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGTTTGTTATGCTTAATATTTTTAGTTTAATTTGCATCTGTCTTAATTCTGCCCTTTATTCAAGCAATTTTTTCTTCACA AAATTGCCCGAGGCCTATGCCTTTTTGAATCCAATCGTAGATTTTATGCCAGTAATCCCTGTACTCTTTTTTCTATTAGC CTTTGTTTGGCAAGCTGCTGTAAGTTTTCGATGAG
Gene structure

JCDB Genes gff download

JCDBG00006 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00006
ID
JCDBR00006
Name
psbK
Type
protein_coding
Scaffold
NC_012224.1
Start
6684
End
6878
Strand
+
Exon
6684-6878
Sequence
TGTTTGTTATGCTTAATATTTTTAGTTTAATTTGCATCTGTCTTAATTCTGCCCTTTATTCAAGCAATTTTTTCTTCACA AAATTGCCCGAGGCCTATGCCTTTTTGAATCCAATCGTAGATTTTATGCCAGTAATCCCTGTACTCTTTTTTCTATTAGC CTTTGTTTGGCAAGCTGCTGTAAGTTTTCGATGAG
Product
Source
RefSeq
Link:
JCDBP00003
ID
JCDBP00003
Parent
JCDBR00006
Name
YP_002720095.1
Scaffold
NC_012224.1
CDS
6684-6878
Strand:
+
Sequence
MFVMLNIFSLICICLNSALYSSNFFFTKLPEAYAFLNPIVDFMPVIPVLFFLLAFVWQAAVSFR
Product
photosystem II protein K
Source
RefSeq
Link
YP_002720095.1
InterProScan
IPR003687 Photosystem II PsbK
Pfam
PF02533.11 PsbK Family