Detail information of JCDBG00007

JCDBG00007
ID
JCDBG00007
Name
psbI
Type
protein_coding
Scaffold
NC_012224.1
Start
7299
End
7409
Strand
+
Link
Genbank id:7564829
Molecular function
Cellular component
GO:0016020 | membrane
GO:0009539 | photosystem II reaction center
GO:0009523 | photosystem II
Biological process
GO:0015979 | photosynthesis
KEGG
Entry: K02710
Name: psbI
Definition: photosystem II PsbI protein
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGCTTACTCTCAAACTCTTTGTTTACACAGTAGTGATATTCTTTGTTTCTCTCTTCATCTTTGGATTTTTATCTAATGAT CCAGGACGAAATCCTGGACGTGAAGAATAAA
Gene structure

JCDB Genes gff download

JCDBG00007 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00007
ID
JCDBR00007
Name
psbI
Type
protein_coding
Scaffold
NC_012224.1
Start
7299
End
7409
Strand
+
Exon
7299-7409
Sequence
TGCTTACTCTCAAACTCTTTGTTTACACAGTAGTGATATTCTTTGTTTCTCTCTTCATCTTTGGATTTTTATCTAATGAT CCAGGACGAAATCCTGGACGTGAAGAATAAA
Product
Source
RefSeq
Link:
JCDBP00004
ID
JCDBP00004
Parent
JCDBR00007
Name
YP_002720096.1
Scaffold
NC_012224.1
CDS
7299-7409
Strand:
+
Sequence
MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE
Product
photosystem II protein I
Source
RefSeq
Link
YP_002720096.1
InterProScan
IPR003686 Photosystem II PsbI
Pfam
PF02532.10 PsbI Family