Detail information of JCDBG00011

JCDBG00011
ID
JCDBG00011
Name
atpA
Type
protein_coding
Scaffold
NC_012224.1
Start
11147
End
12670
Strand
-
Link
Genbank id:7564833
Molecular function
GO:0005524 | ATP binding
GO:0016820 | hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
GO:0032559 | adenyl ribonucleotide binding
GO:0046933 | proton-transporting ATP synthase activity, rotational mechanism
GO:0046961 | proton-transporting ATPase activity, rotational mechanism
Cellular component
GO:0045261 | proton-transporting ATP synthase complex, catalytic core F(1)
GO:0033178 | proton-transporting two-sector ATPase complex, catalytic domain
Biological process
GO:0046034 | ATP metabolic process
GO:0015986 | ATP synthesis coupled proton transport
GO:0015991 | ATP hydrolysis coupled proton transport
GO:0015992 | proton transport
KEGG
Entry: K02111
Name: ATPF1A, atpA
Definition: F-type H+-transporting ATPase subunit alpha [EC:3.6.3.14]
ko00190:   Oxidative phosphorylation
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
CATGGTAACTATTCGAGCCGACGAGATTAGTAATATTATCCGCGAACGTATTGAACAATATAATAGGGAAGTAAAGATTG TAAATACCGGTACTGTACTTCAAGTAGGCGACGGTATTGCTCGTATTCATGGTCTTGATGAAGTAATGGCAGGGGAATTA GTAGAGTTTGAAGAGGGTACAATAGGCATTGCTCTGAATTTGGAATCAAATAATGTCGGTGTTGTATTAATGGGTGACGG TTTAATGATACAAGAGGGAAGCTCCGTAAAAGCAACAGGAAGAATTGCTCAGATACCGGTGAGTGAGGCTTATTTGGGTC GTGTTATAAATGCTTTGGCTAAACCTATTGACGGTCGAGGTGAAATTTCCGCTTCTGAATCTCGGTTAATTGAATCTCCT GCTCCAGGGATTATTTCTAGACGTTCCGTATATGAGCCTCTTCAAACAGGACTTATTGCTATTGATTCGATGATTCCTAT AGGACGCGGTCAACGAGAATTAATTATTGGGGATAGACAGACCGGTAAAACAGCAGTAGCCACAGATACAATTCTCAATC AACAAGGACAAAATGTAATATGTGTTTATGTAGCTATTGGGCAAAAAGCGTCTTCTGTGGCTCAGGTAGTGACTACTTTA CAGGAAAGAGGAGCAATGGAGTACACTATTGTGGTAGCCGAAACAGCGGATTCCCCGGCTACATTACAATATCTCGCTCC TTATACAGGAGCAGCTCTGGCTGAATATTTTATGTACCGGGAACGACACACTTTAATCATTTATGATGATCTCTCCAAAC AAGCGCAGGCTTATCGCCAAATGTCTCTTCTATTACGAAGACCACCGGGTCGTGAAGCTTATCCAGGAGATGTCTTTTAT TTGCATTCACGCCTTTTGGAAAGAGCCGCTAAATCAAGTTCTCGTTTAGGTGAAGGAAGTATGACTGCTTTACCAATAGT TGAGACCCAATCAGGAGACGTTTCGGCTTATATTCCTACTAATGTAATTTCCATTACAGATGGACAAATATTCTTATCCG CCGATCTATTCAATGCTGGAATCAGACCCGCTATTAATGTGGGTATTTCCGTTTCCAGAGTAGGATCTGCGGCTCAAATT AAAGCTATGAAACAGGTAGCTGGTAAGTTAAAATTGGAATTGGCACAATTCGCAGAATTAGAAGCCTTTGCGCAATTCGC TTCTGATCTCGATAAAGCTACTCAGAATCAATTGGCAAGAGGTCAACGATTACGCGAGTTGCTCAAACAATCCCAATCCG CTCCTCTCACAGTGGAGGAACAGATAATGACTATTTATGCCGGAACGACGGGTTATCTTGATTCATTAGAAGTTGGACAA ATAAAGAAATTTCTCGTTGAGTTACGTACTTACTTAAAAACGAATAAACCTGAGTTCCGAGAAATAATATCTTCTACTAA AACATTCACCGAAGAAGCAGAAAGCCTTTTGAAAGAAGCTATTCAGGAACTGAAGGAGCGTTTTCTTCTTCAGGAACAAG TATA
Gene structure

JCDB Genes gff download

JCDBG00011 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00011's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00011JCDBG00041co-exp0.909905
JCDBG00011JCDBG00021co-exp0.86141
JCDBG00011JCDBG00072co-exp0.837624
JCDBG00011JCDBG00012co-exp0.834419
JCDBG00011JCDBG00100co-exp0.815082
JCDBG00011JCDBG00112co-exp0.812285
JCDBG00011JCDBG17009co-exp0.809982
JCDBG00011JCDBG00073co-exp0.809354
JCDBG00011JCDBG24411co-exp0.804629
JCDBG00011JCDBG00018co-exp0.797195
JCDBG00041JCDBG00021co-exp0.818802
JCDBG00041JCDBG00072co-exp0.831358
JCDBG00041JCDBG00012co-exp0.854468
JCDBG00041JCDBG00100co-exp0.801022
JCDBG00041JCDBG00112co-exp0.811234
JCDBG00041JCDBG17009co-exp0.728336
JCDBG00041JCDBG00073co-exp0.746329
JCDBG00041JCDBG24411co-exp0.74781
JCDBG00041JCDBG00018co-exp0.845236
JCDBG00021JCDBG00072co-exp0.661652
JCDBG00021JCDBG00012co-exp0.880718
JCDBG00021JCDBG00100co-exp0.630426
JCDBG00021JCDBG00112co-exp0.864281
JCDBG00021JCDBG17009co-exp0.781623
JCDBG00021JCDBG00073co-exp0.632592
JCDBG00021JCDBG24411co-exp0.762594
JCDBG00021JCDBG00018co-exp0.638963
JCDBG00072JCDBG00012co-exp0.610987
JCDBG00072JCDBG00100co-exp0.887318
JCDBG00072JCDBG17009co-exp0.667676
JCDBG00072JCDBG00073co-exp0.777219
JCDBG00072JCDBG24411co-exp0.719898
JCDBG00072JCDBG00018co-exp0.789748
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG17009co-exp0.695108
JCDBG00012JCDBG24411co-exp0.755509
JCDBG00012JCDBG00018co-exp0.626476
JCDBG00100JCDBG17009co-exp0.638023
JCDBG00100JCDBG00073co-exp0.863882
JCDBG00100JCDBG24411co-exp0.624998
JCDBG00100JCDBG00018co-exp0.814589
JCDBG00112JCDBG17009co-exp0.685704
JCDBG00112JCDBG24411co-exp0.72274
JCDBG00112JCDBG00018co-exp0.613173
JCDBG17009JCDBG00073co-exp0.690102
JCDBG17009JCDBG24411co-exp0.763374
JCDBG00073JCDBG00018co-exp0.751791
PPI network
node1node2type
JCDBG00011JCDBG03004PPI
JCDBG00011JCDBG03794PPI
JCDBG00011JCDBG19764PPI
JCDBG00011JCDBG21654PPI
JCDBG00011JCDBG11906PPI
JCDBG00011JCDBG00566PPI
JCDBG00011JCDBG01642PPI
JCDBG00011JCDBG02019PPI
JCDBG21654JCDBG11906PPI
JCDBG21654JCDBG00566PPI
JCDBG11906JCDBG00566PPI
JCDBR00011
ID
JCDBR00011
Name
atpA
Type
protein_coding
Scaffold
NC_012224.1
Start
11147
End
12670
Strand
-
Exon
11147-12670
Sequence
CATGGTAACTATTCGAGCCGACGAGATTAGTAATATTATCCGCGAACGTATTGAACAATATAATAGGGAAGTAAAGATTG TAAATACCGGTACTGTACTTCAAGTAGGCGACGGTATTGCTCGTATTCATGGTCTTGATGAAGTAATGGCAGGGGAATTA GTAGAGTTTGAAGAGGGTACAATAGGCATTGCTCTGAATTTGGAATCAAATAATGTCGGTGTTGTATTAATGGGTGACGG TTTAATGATACAAGAGGGAAGCTCCGTAAAAGCAACAGGAAGAATTGCTCAGATACCGGTGAGTGAGGCTTATTTGGGTC GTGTTATAAATGCTTTGGCTAAACCTATTGACGGTCGAGGTGAAATTTCCGCTTCTGAATCTCGGTTAATTGAATCTCCT GCTCCAGGGATTATTTCTAGACGTTCCGTATATGAGCCTCTTCAAACAGGACTTATTGCTATTGATTCGATGATTCCTAT AGGACGCGGTCAACGAGAATTAATTATTGGGGATAGACAGACCGGTAAAACAGCAGTAGCCACAGATACAATTCTCAATC AACAAGGACAAAATGTAATATGTGTTTATGTAGCTATTGGGCAAAAAGCGTCTTCTGTGGCTCAGGTAGTGACTACTTTA CAGGAAAGAGGAGCAATGGAGTACACTATTGTGGTAGCCGAAACAGCGGATTCCCCGGCTACATTACAATATCTCGCTCC TTATACAGGAGCAGCTCTGGCTGAATATTTTATGTACCGGGAACGACACACTTTAATCATTTATGATGATCTCTCCAAAC AAGCGCAGGCTTATCGCCAAATGTCTCTTCTATTACGAAGACCACCGGGTCGTGAAGCTTATCCAGGAGATGTCTTTTAT TTGCATTCACGCCTTTTGGAAAGAGCCGCTAAATCAAGTTCTCGTTTAGGTGAAGGAAGTATGACTGCTTTACCAATAGT TGAGACCCAATCAGGAGACGTTTCGGCTTATATTCCTACTAATGTAATTTCCATTACAGATGGACAAATATTCTTATCCG CCGATCTATTCAATGCTGGAATCAGACCCGCTATTAATGTGGGTATTTCCGTTTCCAGAGTAGGATCTGCGGCTCAAATT AAAGCTATGAAACAGGTAGCTGGTAAGTTAAAATTGGAATTGGCACAATTCGCAGAATTAGAAGCCTTTGCGCAATTCGC TTCTGATCTCGATAAAGCTACTCAGAATCAATTGGCAAGAGGTCAACGATTACGCGAGTTGCTCAAACAATCCCAATCCG CTCCTCTCACAGTGGAGGAACAGATAATGACTATTTATGCCGGAACGACGGGTTATCTTGATTCATTAGAAGTTGGACAA ATAAAGAAATTTCTCGTTGAGTTACGTACTTACTTAAAAACGAATAAACCTGAGTTCCGAGAAATAATATCTTCTACTAA AACATTCACCGAAGAAGCAGAAAGCCTTTTGAAAGAAGCTATTCAGGAACTGAAGGAGCGTTTTCTTCTTCAGGAACAAG TATA
Product
Source
RefSeq
Link:
JCDBP00005
ID
JCDBP00005
Parent
JCDBR00011
Name
YP_002720097.1
Scaffold
NC_012224.1
CDS
11147-12670
Strand:
-
Sequence
MVTIRADEISNIIRERIEQYNREVKIVNTGTVLQVGDGIARIHGLDEVMAGELVEFEEGTIGIALNLESNNVGVVLMGDG LMIQEGSSVKATGRIAQIPVSEAYLGRVINALAKPIDGRGEISASESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPI GRGQRELIIGDRQTGKTAVATDTILNQQGQNVICVYVAIGQKASSVAQVVTTLQERGAMEYTIVVAETADSPATLQYLAP YTGAALAEYFMYRERHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKSSSRLGEGSMTALPIV ETQSGDVSAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFAQFA SDLDKATQNQLARGQRLRELLKQSQSAPLTVEEQIMTIYAGTTGYLDSLEVGQIKKFLVELRTYLKTNKPEFREIISSTK TFTEEAESLLKEAIQELKERFLLQEQV
Product
ATP synthase CF1 alpha subunit
Source
RefSeq
Link
YP_002720097.1
InterProScan
IPR000194 ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain
IPR000793 ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal
IPR004100 ATPase, F1 complex alpha/beta subunit, N-terminal domain
IPR005294 ATPase, F1 complex, alpha subunit
IPR020003 ATPase, alpha/beta subunit, nucleotide-binding domain, active site
IPR023366 ATP synthase subunit alpha-like domain
IPR027417 P-loop containing nucleoside triphosphate hydrolase
IPR033732 ATPase, F1 complex, alpha subunit nucleotide-binding domain
Pfam
PF02874.19 ATP-synt_ab_N Domain
PF00006.21 ATP-synt_ab Family
PF00306.23 ATP-synt_ab_C Domain