Detail information of JCDBG00012

JCDBG00012
ID
JCDBG00012
Name
atpF
Type
protein_coding
Scaffold
NC_012224.1
Start
12729
End
13966
Strand
-
Link
Genbank id:7564834
Molecular function
GO:0015078 | hydrogen ion transmembrane transporter activity
Cellular component
GO:0045263 | proton-transporting ATP synthase complex, coupling factor F(o)
Biological process
GO:0015986 | ATP synthesis coupled proton transport
KEGG
Entry: K02109
Name: ATPF0B, atpF
Definition: F-type H+-transporting ATPase subunit b
ko00190:   Oxidative phosphorylation
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TATGAAAAACGTAACCGATTCTTTCGTTTCCTTGGGTCACTGGCCATCCGCCGGGAGTTTCGGGTTTAATACCGATATTT TAGCAACAAATCCAATAAATCTAAGTGTAGTCCTTGGTGTATTAATTTTTTTTGGAAAGGGGGTGTGTGCGAGTTGTTTA TTTCAAGAATAGGCTGGATTGACCCAGCTGCGCTTTTTTCGTTTTAACTAGGAAAGACAAGGTGCATGATCCTGCGAATT ACTTCTGAATAAATTAAGAAATCATCTTTAAGAACCATAGCAGTTCGTGATTCATGGGTAAATATACTTTGATTCTCTAT CAACCAATAACGTGGGACCATTAACATGGTTAAAGCTAAATTGTTTGAAGTCTAGACGCAGCAAGGTACTCTTTCTACTA CTATGGTTAATATAAAAATGAAATGGGTTCAAAATAAATGAAATAGTTTTCGGTATAGAACACTCATGTCGAAAAAAGGA TTTGAACCCCTTTTTTTTTAATGGGTATTTCGCCCATTCTTATTCAATGCTGAGTCGATAACCTATGCATTAAAGTAAAT TCTTTGGATTTGAATTTGAAGAAAAAAAAAAAAGAAACAACTTTACTGACAATTACTTGTTTGGTCAGAAGAGTCCTCCG AATATTCCGGTCTTGGATTAGTGATTAGTTTCAATATTTTTTTTTGGAATATGAATTATGAATAAAGAAGAGAGGATAGG CTCATTTCAGTCAAAAAAGATATGGGAATTTTCCCATAAGTAATTGAAAAAAAAATGGAGCGTGAGAGCCAAATGAATCG AAAGATTCATGTTTGGTTCGGGAAGGGATCATGGAAGTTTTGCAATGAATGGAAAGATAATCTACTTTCATTAAGTGATT TATTAGATAATCGAAAACAAAGGATTTTGGATACTATTCGAAATTCAGAAGAACTACGTGAGGGGGCCATTGAACGGCTG GAAAAAGCCCGGGCCCGCTTACGGAAAGTGGAAATAGAAGCAGATCAGTTTCGAATGAATGGATACTCTGAGATAGAACG AGAAAAATCGAATTTGATTAATTCAACTTCTAAGACTTTAGAACAATTAGAAAATTACAAAAACGAAACCATTCATTTTG AACAACAAAGAACGATTAATCAAGTCCGACAACGGGTTTTCCAACAAGCCTTACAAGGAGCTCTAGGAACTCTGAATAGT TCTTTGACCAACGAGTTACATTTACGTACCATCAATTA
Gene structure

JCDB Genes gff download

JCDBG00012 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00012's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00012JCDBG00037co-exp0.963833
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG00046co-exp0.949104
JCDBG00012JCDBG00065co-exp0.946607
JCDBG00012JCDBG00063co-exp0.938615
JCDBG00012JCDBG00032co-exp0.935341
JCDBG00012JCDBG11239co-exp0.912939
JCDBG00012JCDBG00075co-exp0.912519
JCDBG00012JCDBG00070co-exp0.911621
JCDBG00012JCDBG00062co-exp0.910668
JCDBG00037JCDBG00112co-exp0.958141
JCDBG00037JCDBG00046co-exp0.956923
JCDBG00037JCDBG00065co-exp0.962165
JCDBG00037JCDBG00063co-exp0.966339
JCDBG00037JCDBG00032co-exp0.917854
JCDBG00037JCDBG11239co-exp0.943379
JCDBG00037JCDBG00075co-exp0.939222
JCDBG00037JCDBG00070co-exp0.943138
JCDBG00037JCDBG00062co-exp0.934869
JCDBG00112JCDBG00046co-exp0.924872
JCDBG00112JCDBG00065co-exp0.944148
JCDBG00112JCDBG00063co-exp0.929563
JCDBG00112JCDBG00032co-exp0.894441
JCDBG00112JCDBG11239co-exp0.919971
JCDBG00112JCDBG00075co-exp0.92744
JCDBG00112JCDBG00070co-exp0.886046
JCDBG00112JCDBG00062co-exp0.902815
JCDBG00046JCDBG00065co-exp0.954196
JCDBG00046JCDBG00063co-exp0.932346
JCDBG00046JCDBG00032co-exp0.945749
JCDBG00046JCDBG11239co-exp0.899265
JCDBG00046JCDBG00075co-exp0.886163
JCDBG00046JCDBG00070co-exp0.918786
JCDBG00046JCDBG00062co-exp0.908979
JCDBG00065JCDBG00063co-exp0.942622
JCDBG00065JCDBG00032co-exp0.899738
JCDBG00065JCDBG11239co-exp0.91345
JCDBG00065JCDBG00075co-exp0.920844
JCDBG00065JCDBG00070co-exp0.908277
JCDBG00065JCDBG00062co-exp0.946062
JCDBG00063JCDBG00032co-exp0.894993
JCDBG00063JCDBG11239co-exp0.950032
JCDBG00063JCDBG00075co-exp0.953019
JCDBG00063JCDBG00070co-exp0.952478
JCDBG00063JCDBG00062co-exp0.914786
JCDBG00032JCDBG11239co-exp0.833857
JCDBG00032JCDBG00075co-exp0.821295
JCDBG00032JCDBG00070co-exp0.913395
JCDBG00032JCDBG00062co-exp0.87634
JCDBG11239JCDBG00075co-exp0.952265
JCDBG11239JCDBG00070co-exp0.898642
JCDBG11239JCDBG00062co-exp0.888295
JCDBG00075JCDBG00070co-exp0.901847
JCDBG00075JCDBG00062co-exp0.905767
JCDBG00070JCDBG00062co-exp0.90613
PPI network
node1node2type
JCDBR00012
ID
JCDBR00012
Name
atpF
Type
protein_coding
Scaffold
NC_012224.1
Start
12729
End
13966
Strand
-
Exon
12729-13082,13808-13966
Sequence
TATGAAAAACGTAACCGATTCTTTCGTTTCCTTGGGTCACTGGCCATCCGCCGGGAGTTTCGGGTTTAATACCGATATTT TAGCAACAAATCCAATAAATCTAAGTGTAGTCCTTGGTGTATTAATTTTTTTTGGAAAGGGGGTGTGTGCGAGTTGTTTA TTTCAAGAATAGGCTGGATTGACCCAGCTGCGCTTTTTTCGTTTTAACTAGGAAAGACAAGGTGCATGATCCTGCGAATT ACTTCTGAATAAATTAAGAAATCATCTTTAAGAACCATAGCAGTTCGTGATTCATGGGTAAATATACTTTGATTCTCTAT CAACCAATAACGTGGGACCATTAACATGGTTAAAGCTAAATTGTTTGAAGTCTAGACGCAGCAAGGTACTCTTTCTACTA CTATGGTTAATATAAAAATGAAATGGGTTCAAAATAAATGAAATAGTTTTCGGTATAGAACACTCATGTCGAAAAAAGGA TTTGAACCCCTTTTTTTTTAATGGGTATTTCGCCCATTCTTATTCAATGCTGAGTCGATAACCTATGCATTAAAGTAAAT TCTTTGGATTTGAATTTGAAGAAAAAAAAAAAAGAAACAACTTTACTGACAATTACTTGTTTGGTCAGAAGAGTCCTCCG AATATTCCGGTCTTGGATTAGTGATTAGTTTCAATATTTTTTTTTGGAATATGAATTATGAATAAAGAAGAGAGGATAGG CTCATTTCAGTCAAAAAAGATATGGGAATTTTCCCATAAGTAATTGAAAAAAAAATGGAGCGTGAGAGCCAAATGAATCG AAAGATTCATGTTTGGTTCGGGAAGGGATCATGGAAGTTTTGCAATGAATGGAAAGATAATCTACTTTCATTAAGTGATT TATTAGATAATCGAAAACAAAGGATTTTGGATACTATTCGAAATTCAGAAGAACTACGTGAGGGGGCCATTGAACGGCTG GAAAAAGCCCGGGCCCGCTTACGGAAAGTGGAAATAGAAGCAGATCAGTTTCGAATGAATGGATACTCTGAGATAGAACG AGAAAAATCGAATTTGATTAATTCAACTTCTAAGACTTTAGAACAATTAGAAAATTACAAAAACGAAACCATTCATTTTG AACAACAAAGAACGATTAATCAAGTCCGACAACGGGTTTTCCAACAAGCCTTACAAGGAGCTCTAGGAACTCTGAATAGT TCTTTGACCAACGAGTTACATTTACGTACCATCAATTA
Product
Source
RefSeq
Link:
JCDBP00006
ID
JCDBP00006
Parent
JCDBR00012
Name
YP_002720098.1
Scaffold
NC_012224.1
CDS
12729-13082,13808-13966
Strand:
-
Sequence
MKNVTDSFVSLGHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVCASCLDNRKQRILDTIRNSEELREGAIERLEK ARARLRKVEIEADQFRMNGYSEIEREKSNLINSTSKTLEQLENYKNETIHFEQQRTINQVRQRVFQQALQGALGTLNSSL TNELHLRTIN
Product
ATP synthase CF0 B subunit
Source
RefSeq
Link
YP_002720098.1
InterProScan
IPR002146 ATPase, F0 complex, subunit B/B', bacterial/chloroplast
Pfam
PF00430.14 ATP-synt_B Family