Detail information of JCDBG00013

JCDBG00013
ID
JCDBG00013
Name
atpH
Type
protein_coding
Scaffold
NC_012224.1
Start
14657
End
14902
Strand
-
Link
Genbank id:7564835 | Jatropha Genome Database ID:Jcr4S28292.30
Molecular function
GO:0015078 | hydrogen ion transmembrane transporter activity
Cellular component
GO:0045263 | proton-transporting ATP synthase complex, coupling factor F(o)
GO:0033177 | proton-transporting two-sector ATPase complex, proton-transporting domain
Biological process
GO:0015986 | ATP synthesis coupled proton transport
GO:0015991 | ATP hydrolysis coupled proton transport
KEGG
Entry: K02110
Name: ATPF0C, atpE
Definition: F-type H+-transporting ATPase subunit c
ko00190:   Oxidative phosphorylation
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
CATGAATCCATTGATTTCTGCCGCTTCCGTTATTGCTGCTGGGTTGGCTGTTGGGCTTGCTTCTATTGGACCTGGGGTTG GTCAAGGTACTGCCGCGGGCCAAGCTGTAGAAGGTATCGCAAGACAACCCGAGGCGGAGGGAAAAATACGAGGTACTTTA TTGCTTAGTCTGGCTTTTATGGAAGCTTTAACAATTTATGGACTGGTTGTAGCATTAGCACTTTTATTTGCGAATCCTTT TGTTTA
Gene structure

JCDB Genes gff download

JCDBG00013 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00013's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00013JCDBG00043co-exp0.958265
JCDBG00013JCDBG00029co-exp0.954387
JCDBG00013JCDBG00064co-exp0.907456
JCDBG00013JCDBG00020co-exp0.882966
JCDBG00013JCDBG00014co-exp0.863631
JCDBG00013JCDBG17813co-exp-0.816654
JCDBG00013JCDBG23282co-exp-0.816472
JCDBG00013JCDBG00015co-exp0.801903
JCDBG00013JCDBG10264co-exp0.800996
JCDBG00013JCDBG22369co-exp-0.798448
JCDBG00043JCDBG00029co-exp0.950823
JCDBG00043JCDBG00064co-exp0.912455
JCDBG00043JCDBG00020co-exp0.888094
JCDBG00043JCDBG00014co-exp0.885746
JCDBG00043JCDBG17813co-exp-0.795074
JCDBG00043JCDBG23282co-exp-0.758512
JCDBG00043JCDBG00015co-exp0.838211
JCDBG00043JCDBG10264co-exp0.741051
JCDBG00043JCDBG22369co-exp-0.793166
JCDBG00029JCDBG00064co-exp0.87883
JCDBG00029JCDBG00020co-exp0.868454
JCDBG00029JCDBG00014co-exp0.879308
JCDBG00029JCDBG17813co-exp-0.787629
JCDBG00029JCDBG23282co-exp-0.771614
JCDBG00029JCDBG00015co-exp0.810684
JCDBG00029JCDBG10264co-exp0.747717
JCDBG00029JCDBG22369co-exp-0.726622
JCDBG00064JCDBG00020co-exp0.899486
JCDBG00064JCDBG00014co-exp0.756636
JCDBG00064JCDBG17813co-exp-0.814532
JCDBG00064JCDBG23282co-exp-0.728394
JCDBG00064JCDBG00015co-exp0.698302
JCDBG00064JCDBG10264co-exp0.727377
JCDBG00064JCDBG22369co-exp-0.779209
JCDBG00020JCDBG00014co-exp0.710887
JCDBG00020JCDBG17813co-exp-0.793444
JCDBG00020JCDBG23282co-exp-0.698095
JCDBG00020JCDBG00015co-exp0.679902
JCDBG00020JCDBG10264co-exp0.656906
JCDBG00020JCDBG22369co-exp-0.795139
JCDBG00014JCDBG17813co-exp-0.644969
JCDBG00014JCDBG23282co-exp-0.652831
JCDBG00014JCDBG00015co-exp0.962428
JCDBG00014JCDBG10264co-exp0.659931
JCDBG17813JCDBG23282co-exp0.818679
JCDBG17813JCDBG10264co-exp-0.676734
JCDBG17813JCDBG22369co-exp0.84426
JCDBG23282JCDBG10264co-exp-0.779197
JCDBG23282JCDBG22369co-exp0.755973
JCDBG00015JCDBG10264co-exp0.600148
JCDBG10264JCDBG22369co-exp-0.656783
PPI network
node1node2type
JCDBG00013JCDBG03287PPI
JCDBR00013
ID
JCDBR00013
Name
atpH
Type
protein_coding
Scaffold
NC_012224.1
Start
14657
End
14902
Strand
-
Exon
14657-14902
Sequence
CATGAATCCATTGATTTCTGCCGCTTCCGTTATTGCTGCTGGGTTGGCTGTTGGGCTTGCTTCTATTGGACCTGGGGTTG GTCAAGGTACTGCCGCGGGCCAAGCTGTAGAAGGTATCGCAAGACAACCCGAGGCGGAGGGAAAAATACGAGGTACTTTA TTGCTTAGTCTGGCTTTTATGGAAGCTTTAACAATTTATGGACTGGTTGTAGCATTAGCACTTTTATTTGCGAATCCTTT TGTTTA
Product
Source
RefSeq
Link:
JCDBP00007
ID
JCDBP00007
Parent
JCDBR00013
Name
YP_002720099.1
Scaffold
NC_012224.1
CDS
14657-14902
Strand:
-
Sequence
MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFANPF V
Product
ATP synthase CF0 C subunit
Source
RefSeq
Link
YP_002720099.1
InterProScan
IPR000454 ATPase, F0 complex, subunit C
IPR002379 V-ATPase proteolipid subunit C-like domain
IPR005953 ATPase, F0 complex, subunit C, bacterial/chloroplast
IPR020537 ATPase, F0 complex, subunit C, DCCD-binding site
Pfam
PF00137.17 ATP-synt_C Family