Detail information of JCDBG00014

JCDBG00014
ID
JCDBG00014
Name
atpI
Type
protein_coding
Scaffold
NC_012224.1
Start
16131
End
16874
Strand
-
Link
Genbank id:7564836 | Jatropha Genome Database ID:Jcr4U31230.10
Molecular function
GO:0015078 | hydrogen ion transmembrane transporter activity
Cellular component
Biological process
GO:0015986 | ATP synthesis coupled proton transport
KEGG
Entry: K02108
Name: ATPF0A, atpB
Definition: F-type H+-transporting ATPase subunit a
ko00190:   Oxidative phosphorylation
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TATGAATGTTCTATCATGTTCCATAAACACACTAAAAGGGTTATATGATATATCCGGTGTGGAAGTAGGCCAGCATTTCT ATTGGAAAATAGGAGGTTTCCAAGTCCATGCCCAAGTACTTATTACTTCTTGGGTTGTAATTACTATCTTATTAGGTTCA GCCATTGTAGCTGTTCGGAATCCACAAACCATTCCGACTGGCGGGCAGAATTTCTTCGAATATGTCCTTGAATTCATTCG GGATGTGAGCAAAACTCAGATTGGAGAGGAATATGGCTCATGGGTCCCCTTTATTGGAACTATGTTTTTATTTATTTTTG TTTCTAATTGGGCTGGGGCGCTTTTGCCTTGGAAGATCATAGAGTTACCTCATGGGGAGTTAGCCGCACCTACGAATGAT ATAAATACTACCGTTGCTTTAGCTTTACTTACGTCAATAGCATATTTTTATGCGGGCCTTAGGAAAAAAGGATTAGGTTA TTTCAGCAAATACATTCAGCCAACTCCAATCCTTTTACCCATTAACATTTTAGAAGATTTCACAAAACCTTTATCACTTA GCTTTCGACTTTTCGGAAATATATTAGCGGACGAATTAGTAGTTGTTGTTCTTGTTTCTTTAGTACCTTCAGTGGTTCCT ATACCTGTCATGTTCCTTGGATTATTTACAAGCGGTATTCAAGCTCTTATTTTTGCAACTTTAGCCGCGGCTTATATAGG CGAATCCATGGAGGGGCATCATTG
Gene structure

JCDB Genes gff download

JCDBG00014 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00014's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00014JCDBG00015co-exp0.962428
JCDBG00014JCDBG00076co-exp0.927644
JCDBG00014JCDBG00074co-exp0.908064
JCDBG00014JCDBG00042co-exp0.895739
JCDBG00014JCDBG00043co-exp0.885746
JCDBG00014JCDBG00016co-exp0.880861
JCDBG00014JCDBG00029co-exp0.879308
JCDBG00014JCDBG00013co-exp0.863631
JCDBG00014JCDBG00066co-exp0.856988
JCDBG00014JCDBG00073co-exp0.847308
JCDBG00015JCDBG00076co-exp0.930852
JCDBG00015JCDBG00074co-exp0.915663
JCDBG00015JCDBG00042co-exp0.895991
JCDBG00015JCDBG00043co-exp0.838211
JCDBG00015JCDBG00016co-exp0.940419
JCDBG00015JCDBG00029co-exp0.810684
JCDBG00015JCDBG00013co-exp0.801903
JCDBG00015JCDBG00066co-exp0.817076
JCDBG00015JCDBG00073co-exp0.832888
JCDBG00076JCDBG00074co-exp0.954077
JCDBG00076JCDBG00042co-exp0.878569
JCDBG00076JCDBG00043co-exp0.777139
JCDBG00076JCDBG00016co-exp0.885852
JCDBG00076JCDBG00029co-exp0.780435
JCDBG00076JCDBG00013co-exp0.754789
JCDBG00076JCDBG00066co-exp0.790643
JCDBG00076JCDBG00073co-exp0.907254
JCDBG00074JCDBG00042co-exp0.855675
JCDBG00074JCDBG00043co-exp0.72181
JCDBG00074JCDBG00016co-exp0.898756
JCDBG00074JCDBG00029co-exp0.721363
JCDBG00074JCDBG00013co-exp0.710655
JCDBG00074JCDBG00066co-exp0.812118
JCDBG00074JCDBG00073co-exp0.919097
JCDBG00042JCDBG00043co-exp0.744324
JCDBG00042JCDBG00016co-exp0.87673
JCDBG00042JCDBG00029co-exp0.738498
JCDBG00042JCDBG00013co-exp0.680279
JCDBG00042JCDBG00066co-exp0.761356
JCDBG00042JCDBG00073co-exp0.877775
JCDBG00043JCDBG00016co-exp0.685365
JCDBG00043JCDBG00029co-exp0.950823
JCDBG00043JCDBG00013co-exp0.958265
JCDBG00043JCDBG00066co-exp0.801506
JCDBG00043JCDBG00073co-exp0.617755
JCDBG00016JCDBG00029co-exp0.65824
JCDBG00016JCDBG00013co-exp0.652062
JCDBG00016JCDBG00066co-exp0.814743
JCDBG00016JCDBG00073co-exp0.842042
JCDBG00029JCDBG00013co-exp0.954387
JCDBG00029JCDBG00066co-exp0.741453
JCDBG00029JCDBG00073co-exp0.64327
JCDBG00013JCDBG00066co-exp0.788828
JCDBG00066JCDBG00073co-exp0.745586
PPI network
node1node2type
JCDBR00014
ID
JCDBR00014
Name
atpI
Type
protein_coding
Scaffold
NC_012224.1
Start
16131
End
16874
Strand
-
Exon
16131-16874
Sequence
TATGAATGTTCTATCATGTTCCATAAACACACTAAAAGGGTTATATGATATATCCGGTGTGGAAGTAGGCCAGCATTTCT ATTGGAAAATAGGAGGTTTCCAAGTCCATGCCCAAGTACTTATTACTTCTTGGGTTGTAATTACTATCTTATTAGGTTCA GCCATTGTAGCTGTTCGGAATCCACAAACCATTCCGACTGGCGGGCAGAATTTCTTCGAATATGTCCTTGAATTCATTCG GGATGTGAGCAAAACTCAGATTGGAGAGGAATATGGCTCATGGGTCCCCTTTATTGGAACTATGTTTTTATTTATTTTTG TTTCTAATTGGGCTGGGGCGCTTTTGCCTTGGAAGATCATAGAGTTACCTCATGGGGAGTTAGCCGCACCTACGAATGAT ATAAATACTACCGTTGCTTTAGCTTTACTTACGTCAATAGCATATTTTTATGCGGGCCTTAGGAAAAAAGGATTAGGTTA TTTCAGCAAATACATTCAGCCAACTCCAATCCTTTTACCCATTAACATTTTAGAAGATTTCACAAAACCTTTATCACTTA GCTTTCGACTTTTCGGAAATATATTAGCGGACGAATTAGTAGTTGTTGTTCTTGTTTCTTTAGTACCTTCAGTGGTTCCT ATACCTGTCATGTTCCTTGGATTATTTACAAGCGGTATTCAAGCTCTTATTTTTGCAACTTTAGCCGCGGCTTATATAGG CGAATCCATGGAGGGGCATCATTG
Product
Source
RefSeq
Link:
JCDBP00008
ID
JCDBP00008
Parent
JCDBR00014
Name
YP_002720100.1
Scaffold
NC_012224.1
CDS
16131-16874
Strand:
-
Sequence
MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHAQVLITSWVVITILLGSAIVAVRNPQTIPTGGQNFFEYVLEFIR DVSKTQIGEEYGSWVPFIGTMFLFIFVSNWAGALLPWKIIELPHGELAAPTNDINTTVALALLTSIAYFYAGLRKKGLGY FSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Product
ATP synthase CF0 A subunit
Source
RefSeq
Link
YP_002720100.1
InterProScan
IPR000568 ATPase, F0 complex, subunit A
IPR023011 ATPase, F0 complex, subunit A, active site
Pfam
PF00119.16 ATP-synt_A Domain