Detail information of JCDBG00015

JCDBG00015
ID
JCDBG00015
Name
rps2
Type
protein_coding
Scaffold
NC_012224.1
Start
17086
End
17796
Strand
-
Link
Genbank id:7564837
Molecular function
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0005622 | intracellular
GO:0015935 | small ribosomal subunit
Biological process
GO:0006412 | translation
KEGG
Entry: K02967
Name: RP-S2, MRPS2, rpsB
Definition: small subunit ribosomal protein S2
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
AATGATAAGAAGATATTGGAACATTAATTTGGAAGAGATGATAAAAGCAGGAGTTCATTTTGGTCATGGTACTAGAAAAT GGAATCCGAGAATGGCACCTTATATCTCTGCAAAGCGTAAAGGTATTCATATTACAAATCTTACTAGAACTGCTCGTTTT TTATCAGAAGCTTGTGATTTAGTTTTTGATGCAGCAAGCAGGAGAAAACAATTCTTAATTGTTGGTACAAAAAATAAAGC AGCGGATTCAGTAGCGCGGGCTGCAATAAGGGCTCGGTGTCATTATGTTAATAAAAAATGGCTTGGCGGTATTTTAACGA ATTGGTCCACTACAGAAACTAGACTTCAAAAGTTCAGGGACTTGAGAATGGAACAAAAGGCAGGTAGACTCAACCGTCTT CCGAAAGGAGATGCGGCTCGATTGAAGAGACAGTTAGCTCACTTGCAAACATATCTGGGCGGGATTAAATATATGACGGG GTTACCGGATGTTGTAATAATCGTTGATCAGCAAGAGGAACATACGGCTCTTCGGGAATGTATCACTTTGGGAATTCCAA CGATTTGTTTAATTGATACAAACTGTGATCCGGATCTCGCAGATATTTCGATTCCAGCGAATGATGACGCTATAGCTTCA ATCCGATTAATTCTTAATAAATTAGTATTTGCAATTTGTGAAGGGCGTTCTAGCTATATACGAAATCCCTG
Gene structure

JCDB Genes gff download

JCDBG00015 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00015's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00015JCDBG00014co-exp0.962428
JCDBG00015JCDBG00016co-exp0.940419
JCDBG00015JCDBG00076co-exp0.930852
JCDBG00015JCDBG00074co-exp0.915663
JCDBG00015JCDBG00042co-exp0.895991
JCDBG00015JCDBG00043co-exp0.838211
JCDBG00015JCDBG00017co-exp0.837062
JCDBG00015JCDBG00073co-exp0.832888
JCDBG00015JCDBG00103co-exp0.826044
JCDBG00015JCDBG00100co-exp0.823086
JCDBG00014JCDBG00016co-exp0.880861
JCDBG00014JCDBG00076co-exp0.927644
JCDBG00014JCDBG00074co-exp0.908064
JCDBG00014JCDBG00042co-exp0.895739
JCDBG00014JCDBG00043co-exp0.885746
JCDBG00014JCDBG00017co-exp0.844381
JCDBG00014JCDBG00073co-exp0.847308
JCDBG00014JCDBG00103co-exp0.803491
JCDBG00014JCDBG00100co-exp0.790546
JCDBG00016JCDBG00076co-exp0.885852
JCDBG00016JCDBG00074co-exp0.898756
JCDBG00016JCDBG00042co-exp0.87673
JCDBG00016JCDBG00043co-exp0.685365
JCDBG00016JCDBG00017co-exp0.87755
JCDBG00016JCDBG00073co-exp0.842042
JCDBG00016JCDBG00103co-exp0.779471
JCDBG00016JCDBG00100co-exp0.848717
JCDBG00076JCDBG00074co-exp0.954077
JCDBG00076JCDBG00042co-exp0.878569
JCDBG00076JCDBG00043co-exp0.777139
JCDBG00076JCDBG00017co-exp0.827276
JCDBG00076JCDBG00073co-exp0.907254
JCDBG00076JCDBG00103co-exp0.754901
JCDBG00076JCDBG00100co-exp0.852873
JCDBG00074JCDBG00042co-exp0.855675
JCDBG00074JCDBG00043co-exp0.72181
JCDBG00074JCDBG00017co-exp0.864342
JCDBG00074JCDBG00073co-exp0.919097
JCDBG00074JCDBG00103co-exp0.74983
JCDBG00074JCDBG00100co-exp0.80827
JCDBG00042JCDBG00043co-exp0.744324
JCDBG00042JCDBG00017co-exp0.821724
JCDBG00042JCDBG00073co-exp0.877775
JCDBG00042JCDBG00103co-exp0.774638
JCDBG00042JCDBG00100co-exp0.91609
JCDBG00043JCDBG00017co-exp0.710908
JCDBG00043JCDBG00073co-exp0.617755
JCDBG00043JCDBG00103co-exp0.825906
JCDBG00017JCDBG00073co-exp0.843437
JCDBG00017JCDBG00103co-exp0.787108
JCDBG00017JCDBG00100co-exp0.742444
JCDBG00073JCDBG00103co-exp0.626525
JCDBG00073JCDBG00100co-exp0.863882
JCDBG00103JCDBG00100co-exp0.682033
PPI network
node1node2type
JCDBG00015JCDBG06746PPI
JCDBG00015JCDBG24182PPI
JCDBG00015JCDBG15079PPI
JCDBG00015JCDBG18579PPI
JCDBG00015JCDBG16654PPI
JCDBG00015JCDBG07926PPI
JCDBG00015JCDBG09324PPI
JCDBG00015JCDBG00387PPI
JCDBG00015JCDBG15890PPI
JCDBG00015JCDBG13835PPI
JCDBG00015JCDBG14958PPI
JCDBG00015JCDBG17434PPI
JCDBG00015JCDBG21369PPI
JCDBG00015JCDBG01351PPI
JCDBG00015JCDBG12829PPI
JCDBG00015JCDBG14028PPI
JCDBG00015JCDBG23530PPI
JCDBG00015JCDBG05767PPI
JCDBG00015JCDBG09611PPI
JCDBG00015JCDBG11906PPI
JCDBG00015JCDBG12505PPI
JCDBG00015JCDBG00883PPI
JCDBG00015JCDBG22110PPI
JCDBG00015JCDBG05191PPI
JCDBG00015JCDBG09297PPI
JCDBG00015JCDBG14056PPI
JCDBG00015JCDBG18937PPI
JCDBG00015JCDBG23880PPI
JCDBG00015JCDBG22167PPI
JCDBG00015JCDBG10704PPI
JCDBG00015JCDBG23997PPI
JCDBG00015JCDBG20369PPI
JCDBG00015JCDBG19929PPI
JCDBG00015JCDBG20140PPI
JCDBG00015JCDBG08056PPI
JCDBG00015JCDBG03794PPI
JCDBG00015JCDBG22241PPI
JCDBG00015JCDBG17068PPI
JCDBG00015JCDBG19819PPI
JCDBG00015JCDBG14387PPI
JCDBG00015JCDBG09234PPI
JCDBG00015JCDBG17250PPI
JCDBG00015JCDBG23469PPI
JCDBG00015JCDBG08044PPI
JCDBG00015JCDBG21411PPI
JCDBG00015JCDBG23889PPI
JCDBG00015JCDBG11032PPI
JCDBG00015JCDBG15399PPI
JCDBG00015JCDBG23088PPI
JCDBG00015JCDBG17020PPI
JCDBG00015JCDBG17960PPI
JCDBG00015JCDBG25246PPI
JCDBG00015JCDBG24155PPI
JCDBG00015JCDBG06790PPI
JCDBG00015JCDBG13218PPI
JCDBG00015JCDBG17129PPI
JCDBG00015JCDBG15778PPI
JCDBG00015JCDBG17070PPI
JCDBG00015JCDBG02328PPI
JCDBG00015JCDBG18489PPI
JCDBG00015JCDBG15173PPI
JCDBG00015JCDBG01652PPI
JCDBG00015JCDBG08468PPI
JCDBG00015JCDBG16262PPI
JCDBG00015JCDBG12807PPI
JCDBG00015JCDBG18040PPI
JCDBG00015JCDBG24748PPI
JCDBG00015JCDBG06148PPI
JCDBG00015JCDBG22653PPI
JCDBG00015JCDBG00306PPI
JCDBG00015JCDBG11027PPI
JCDBG00015JCDBG12884PPI
JCDBG00015JCDBG23557PPI
JCDBG00015JCDBG14381PPI
JCDBG00015JCDBG17892PPI
JCDBG00015JCDBG15810PPI
JCDBG00015JCDBG16292PPI
JCDBG00015JCDBG03176PPI
JCDBG00015JCDBG12978PPI
JCDBG00015JCDBG11509PPI
JCDBG00015JCDBG17544PPI
JCDBG00015JCDBG03326PPI
JCDBG00015JCDBG04352PPI
JCDBG00015JCDBG11675PPI
JCDBG00015JCDBG20566PPI
JCDBG00015JCDBG17067PPI
JCDBG00015JCDBG07937PPI
JCDBG00015JCDBG23734PPI
JCDBG00015JCDBG20457PPI
JCDBG00015JCDBG19936PPI
JCDBG00015JCDBG06129PPI
JCDBG00015JCDBG00566PPI
JCDBG00015JCDBG18629PPI
JCDBG00015JCDBG23113PPI
JCDBG00015JCDBG09698PPI
JCDBG00015JCDBG22121PPI
JCDBG00015JCDBG22404PPI
JCDBG00015JCDBG18419PPI
JCDBG00015JCDBG20116PPI
JCDBG00015JCDBG02680PPI
JCDBG00015JCDBG08042PPI
JCDBG00015JCDBG03587PPI
JCDBG00015JCDBG17585PPI
JCDBG00015JCDBG15369PPI
JCDBG00015JCDBG22117PPI
JCDBG00015JCDBG12412PPI
JCDBG00015JCDBG12956PPI
JCDBG06746JCDBG18937PPI
JCDBG06746JCDBG24748PPI
JCDBG24182JCDBG15079PPI
JCDBG24182JCDBG16654PPI
JCDBG24182JCDBG09324PPI
JCDBG24182JCDBG14958PPI
JCDBG24182JCDBG17434PPI
JCDBG24182JCDBG21369PPI
JCDBG24182JCDBG23530PPI
JCDBG24182JCDBG09611PPI
JCDBG24182JCDBG12505PPI
JCDBG24182JCDBG05191PPI
JCDBG24182JCDBG23880PPI
JCDBG24182JCDBG23997PPI
JCDBG24182JCDBG19929PPI
JCDBG24182JCDBG20140PPI
JCDBG24182JCDBG08056PPI
JCDBG24182JCDBG03794PPI
JCDBG24182JCDBG09234PPI
JCDBG24182JCDBG17250PPI
JCDBG24182JCDBG23469PPI
JCDBG24182JCDBG08044PPI
JCDBG24182JCDBG13218PPI
JCDBG24182JCDBG17129PPI
JCDBG24182JCDBG08468PPI
JCDBG24182JCDBG12807PPI
JCDBG24182JCDBG18040PPI
JCDBG24182JCDBG24748PPI
JCDBG24182JCDBG06148PPI
JCDBG24182JCDBG22653PPI
JCDBG24182JCDBG00306PPI
JCDBG24182JCDBG11027PPI
JCDBG24182JCDBG15810PPI
JCDBG24182JCDBG23734PPI
JCDBG24182JCDBG20457PPI
JCDBG24182JCDBG19936PPI
JCDBG24182JCDBG06129PPI
JCDBG24182JCDBG23113PPI
JCDBG24182JCDBG18419PPI
JCDBG24182JCDBG02680PPI
JCDBG24182JCDBG08042PPI
JCDBG24182JCDBG03587PPI
JCDBG24182JCDBG22117PPI
JCDBG15079JCDBG23880PPI
JCDBG15079JCDBG17068PPI
JCDBG15079JCDBG17070PPI
JCDBG15079JCDBG06148PPI
JCDBG15079JCDBG17067PPI
JCDBG18579JCDBG15890PPI
JCDBG18579JCDBG19936PPI
JCDBG16654JCDBG15890PPI
JCDBG16654JCDBG23530PPI
JCDBG16654JCDBG23880PPI
JCDBG16654JCDBG03794PPI
JCDBG16654JCDBG09234PPI
JCDBG16654JCDBG23469PPI
JCDBG16654JCDBG06148PPI
JCDBG16654JCDBG00306PPI
JCDBG16654JCDBG11027PPI
JCDBG16654JCDBG23113PPI
JCDBG16654JCDBG18419PPI
JCDBG16654JCDBG03587PPI
JCDBG07926JCDBG23880PPI
JCDBG07926JCDBG24748PPI
JCDBG07926JCDBG06148PPI
JCDBG07926JCDBG11027PPI
JCDBG07926JCDBG22117PPI
JCDBG09324JCDBG14958PPI
JCDBG09324JCDBG23880PPI
JCDBG09324JCDBG03794PPI
JCDBG09324JCDBG16262PPI
JCDBG09324JCDBG24748PPI
JCDBG09324JCDBG06148PPI
JCDBG09324JCDBG00306PPI
JCDBG09324JCDBG20566PPI
JCDBG09324JCDBG06129PPI
JCDBG09324JCDBG23113PPI
JCDBG09324JCDBG20116PPI
JCDBG00387JCDBG00883PPI
JCDBG00387JCDBG03794PPI
JCDBG00387JCDBG14387PPI
JCDBG00387JCDBG06148PPI
JCDBG00387JCDBG19936PPI
JCDBG00387JCDBG20116PPI
JCDBG15890JCDBG18937PPI
JCDBG15890JCDBG24748PPI
JCDBG14958JCDBG23880PPI
JCDBG14958JCDBG03794PPI
JCDBG14958JCDBG16262PPI
JCDBG14958JCDBG24748PPI
JCDBG14958JCDBG06148PPI
JCDBG14958JCDBG00306PPI
JCDBG14958JCDBG20566PPI
JCDBG14958JCDBG06129PPI
JCDBG14958JCDBG23113PPI
JCDBG14958JCDBG20116PPI
JCDBG17434JCDBG23530PPI
JCDBG17434JCDBG23880PPI
JCDBG17434JCDBG23469PPI
JCDBG17434JCDBG24748PPI
JCDBG17434JCDBG06148PPI
JCDBG17434JCDBG00306PPI
JCDBG17434JCDBG11027PPI
JCDBG17434JCDBG20457PPI
JCDBG17434JCDBG19936PPI
JCDBG17434JCDBG23113PPI
JCDBG17434JCDBG18419PPI
JCDBG21369JCDBG23530PPI
JCDBG21369JCDBG23880PPI
JCDBG21369JCDBG09234PPI
JCDBG21369JCDBG20457PPI
JCDBG21369JCDBG08042PPI
JCDBG21369JCDBG17585PPI
JCDBG12829JCDBG23997PPI
JCDBG12829JCDBG06148PPI
JCDBG12829JCDBG00306PPI
JCDBG12829JCDBG19936PPI
JCDBG12829JCDBG23113PPI
JCDBG12829JCDBG20116PPI
JCDBG14028JCDBG13218PPI
JCDBG14028JCDBG00306PPI
JCDBG14028JCDBG23113PPI
JCDBG23530JCDBG23880PPI
JCDBG23530JCDBG03794PPI
JCDBG23530JCDBG09234PPI
JCDBG23530JCDBG17250PPI
JCDBG23530JCDBG23469PPI
JCDBG23530JCDBG18040PPI
JCDBG23530JCDBG06148PPI
JCDBG23530JCDBG22653PPI
JCDBG23530JCDBG00306PPI
JCDBG23530JCDBG11027PPI
JCDBG23530JCDBG23557PPI
JCDBG23530JCDBG19936PPI
JCDBG23530JCDBG23113PPI
JCDBG23530JCDBG09698PPI
JCDBG23530JCDBG18419PPI
JCDBG23530JCDBG20116PPI
JCDBG23530JCDBG03587PPI
JCDBG05767JCDBG24748PPI
JCDBG09611JCDBG05191PPI
JCDBG09611JCDBG23880PPI
JCDBG09611JCDBG20140PPI
JCDBG09611JCDBG03794PPI
JCDBG09611JCDBG24748PPI
JCDBG09611JCDBG06129PPI
JCDBG09611JCDBG22121PPI
JCDBG11906JCDBG14056PPI
JCDBG11906JCDBG08056PPI
JCDBG11906JCDBG09234PPI
JCDBG11906JCDBG23088PPI
JCDBG11906JCDBG00566PPI
JCDBG11906JCDBG20116PPI
JCDBG12505JCDBG09234PPI
JCDBG12505JCDBG23088PPI
JCDBG00883JCDBG03794PPI
JCDBG00883JCDBG06148PPI
JCDBG00883JCDBG23557PPI
JCDBG00883JCDBG19936PPI
JCDBG00883JCDBG20116PPI
JCDBG22110JCDBG03794PPI
JCDBG22110JCDBG17020PPI
JCDBG22110JCDBG23557PPI
JCDBG22110JCDBG16292PPI
JCDBG05191JCDBG23880PPI
JCDBG05191JCDBG03794PPI
JCDBG05191JCDBG24748PPI
JCDBG05191JCDBG22121PPI
JCDBG09297JCDBG22167PPI
JCDBG09297JCDBG17068PPI
JCDBG09297JCDBG17070PPI
JCDBG09297JCDBG18489PPI
JCDBG09297JCDBG24748PPI
JCDBG09297JCDBG17067PPI
JCDBG14056JCDBG22167PPI
JCDBG14056JCDBG23088PPI
JCDBG14056JCDBG17960PPI
JCDBG14056JCDBG03176PPI
JCDBG14056JCDBG00566PPI
JCDBG18937JCDBG10704PPI
JCDBG18937JCDBG23088PPI
JCDBG18937JCDBG16262PPI
JCDBG18937JCDBG24748PPI
JCDBG18937JCDBG06148PPI
JCDBG18937JCDBG18419PPI
JCDBG18937JCDBG08042PPI
JCDBG23880JCDBG23997PPI
JCDBG23880JCDBG19929PPI
JCDBG23880JCDBG20140PPI
JCDBG23880JCDBG03794PPI
JCDBG23880JCDBG23469PPI
JCDBG23880JCDBG08044PPI
JCDBG23880JCDBG23889PPI
JCDBG23880JCDBG25246PPI
JCDBG23880JCDBG17129PPI
JCDBG23880JCDBG08468PPI
JCDBG23880JCDBG18040PPI
JCDBG23880JCDBG24748PPI
JCDBG23880JCDBG06148PPI
JCDBG23880JCDBG22653PPI
JCDBG23880JCDBG17892PPI
JCDBG23880JCDBG04352PPI
JCDBG23880JCDBG23734PPI
JCDBG23880JCDBG20457PPI
JCDBG23880JCDBG19936PPI
JCDBG23880JCDBG20116PPI
JCDBG23880JCDBG08042PPI
JCDBG23880JCDBG03587PPI
JCDBG23880JCDBG17585PPI
JCDBG22167JCDBG23088PPI
JCDBG22167JCDBG18489PPI
JCDBG10704JCDBG03794PPI
JCDBG10704JCDBG23088PPI
JCDBG10704JCDBG24748PPI
JCDBG23997JCDBG03794PPI
JCDBG23997JCDBG09234PPI
JCDBG23997JCDBG16262PPI
JCDBG23997JCDBG06148PPI
JCDBG23997JCDBG00306PPI
JCDBG23997JCDBG23113PPI
JCDBG20369JCDBG14387PPI
JCDBG20369JCDBG21411PPI
JCDBG20369JCDBG00306PPI
JCDBG20369JCDBG12884PPI
JCDBG20369JCDBG23557PPI
JCDBG20369JCDBG14381PPI
JCDBG20369JCDBG07937PPI
JCDBG20369JCDBG23113PPI
JCDBG20369JCDBG09698PPI
JCDBG19929JCDBG03794PPI
JCDBG19929JCDBG09234PPI
JCDBG19929JCDBG24748PPI
JCDBG19929JCDBG06148PPI
JCDBG19929JCDBG18419PPI
JCDBG19929JCDBG17585PPI
JCDBG20140JCDBG03794PPI
JCDBG20140JCDBG24748PPI
JCDBG20140JCDBG06148PPI
JCDBG20140JCDBG22653PPI
JCDBG20140JCDBG22121PPI
JCDBG20140JCDBG18419PPI
JCDBG20140JCDBG20116PPI
JCDBG08056JCDBG24748PPI
JCDBG08056JCDBG06129PPI
JCDBG08056JCDBG00566PPI
JCDBG08056JCDBG17585PPI
JCDBG03794JCDBG14387PPI
JCDBG03794JCDBG09234PPI
JCDBG03794JCDBG23469PPI
JCDBG03794JCDBG17129PPI
JCDBG03794JCDBG06148PPI
JCDBG03794JCDBG22653PPI
JCDBG03794JCDBG15810PPI
JCDBG03794JCDBG17544PPI
JCDBG03794JCDBG04352PPI
JCDBG03794JCDBG19936PPI
JCDBG03794JCDBG09698PPI
JCDBG03794JCDBG18419PPI
JCDBG03794JCDBG20116PPI
JCDBG03794JCDBG03587PPI
JCDBG17068JCDBG15399PPI
JCDBG17068JCDBG17070PPI
JCDBG17068JCDBG18489PPI
JCDBG17068JCDBG24748PPI
JCDBG17068JCDBG17067PPI
JCDBG19819JCDBG23088PPI
JCDBG14387JCDBG00306PPI
JCDBG14387JCDBG12884PPI
JCDBG14387JCDBG03326PPI
JCDBG14387JCDBG07937PPI
JCDBG14387JCDBG19936PPI
JCDBG14387JCDBG23113PPI
JCDBG09234JCDBG15778PPI
JCDBG09234JCDBG24748PPI
JCDBG09234JCDBG20457PPI
JCDBG09234JCDBG06129PPI
JCDBG09234JCDBG00566PPI
JCDBG09234JCDBG08042PPI
JCDBG17250JCDBG24748PPI
JCDBG17250JCDBG06129PPI
JCDBG23469JCDBG06148PPI
JCDBG23469JCDBG11027PPI
JCDBG23469JCDBG19936PPI
JCDBG23469JCDBG18419PPI
JCDBG23469JCDBG20116PPI
JCDBG23469JCDBG03587PPI
JCDBG23469JCDBG17585PPI
JCDBG08044JCDBG23088PPI
JCDBG08044JCDBG16262PPI
JCDBG08044JCDBG00306PPI
JCDBG08044JCDBG12978PPI
JCDBG08044JCDBG17544PPI
JCDBG08044JCDBG04352PPI
JCDBG08044JCDBG23734PPI
JCDBG08044JCDBG23113PPI
JCDBG08044JCDBG18419PPI
JCDBG08044JCDBG20116PPI
JCDBG21411JCDBG00306PPI
JCDBG21411JCDBG23113PPI
JCDBG23889JCDBG18040PPI
JCDBG15399JCDBG17070PPI
JCDBG15399JCDBG17067PPI
JCDBG23088JCDBG17960PPI
JCDBG23088JCDBG24155PPI
JCDBG23088JCDBG12978PPI
JCDBG23088JCDBG03326PPI
JCDBG23088JCDBG00566PPI
JCDBG23088JCDBG22121PPI
JCDBG23088JCDBG22404PPI
JCDBG25246JCDBG24748PPI
JCDBG25246JCDBG06148PPI
JCDBG13218JCDBG18040PPI
JCDBG13218JCDBG06148PPI
JCDBG17129JCDBG24748PPI
JCDBG17129JCDBG18419PPI
JCDBG15778JCDBG16262PPI
JCDBG15778JCDBG24748PPI
JCDBG15778JCDBG06148PPI
JCDBG17070JCDBG18489PPI
JCDBG17070JCDBG24748PPI
JCDBG17070JCDBG17067PPI
JCDBG18489JCDBG24748PPI
JCDBG18489JCDBG17067PPI
JCDBG15173JCDBG20116PPI
JCDBG01652JCDBG12956PPI
JCDBG08468JCDBG06148PPI
JCDBG08468JCDBG00306PPI
JCDBG08468JCDBG23113PPI
JCDBG08468JCDBG09698PPI
JCDBG08468JCDBG18419PPI
JCDBG08468JCDBG03587PPI
JCDBG08468JCDBG17585PPI
JCDBG12807JCDBG06148PPI
JCDBG12807JCDBG20116PPI
JCDBG18040JCDBG06148PPI
JCDBG24748JCDBG22653PPI
JCDBG24748JCDBG11027PPI
JCDBG24748JCDBG04352PPI
JCDBG24748JCDBG17067PPI
JCDBG24748JCDBG23734PPI
JCDBG24748JCDBG20457PPI
JCDBG24748JCDBG06129PPI
JCDBG24748JCDBG22121PPI
JCDBG24748JCDBG02680PPI
JCDBG24748JCDBG08042PPI
JCDBG24748JCDBG17585PPI
JCDBG06148JCDBG22653PPI
JCDBG06148JCDBG00306PPI
JCDBG06148JCDBG15810PPI
JCDBG06148JCDBG04352PPI
JCDBG06148JCDBG11675PPI
JCDBG06148JCDBG23734PPI
JCDBG06148JCDBG20457PPI
JCDBG06148JCDBG19936PPI
JCDBG06148JCDBG23113PPI
JCDBG06148JCDBG22121PPI
JCDBG06148JCDBG03587PPI
JCDBG06148JCDBG15369PPI
JCDBG22653JCDBG03587PPI
JCDBG00306JCDBG12884PPI
JCDBG00306JCDBG23557PPI
JCDBG00306JCDBG14381PPI
JCDBG00306JCDBG11675PPI
JCDBG00306JCDBG20457PPI
JCDBG00306JCDBG18419PPI
JCDBG00306JCDBG02680PPI
JCDBG00306JCDBG08042PPI
JCDBG00306JCDBG03587PPI
JCDBG00306JCDBG12412PPI
JCDBG11027JCDBG23557PPI
JCDBG11027JCDBG18419PPI
JCDBG12884JCDBG23557PPI
JCDBG12884JCDBG14381PPI
JCDBG12884JCDBG23113PPI
JCDBG23557JCDBG23113PPI
JCDBG14381JCDBG23113PPI
JCDBG14381JCDBG09698PPI
JCDBG15810JCDBG18419PPI
JCDBG04352JCDBG06129PPI
JCDBG04352JCDBG22121PPI
JCDBG04352JCDBG17585PPI
JCDBG11675JCDBG20566PPI
JCDBG11675JCDBG19936PPI
JCDBG11675JCDBG23113PPI
JCDBG20457JCDBG19936PPI
JCDBG20457JCDBG23113PPI
JCDBG19936JCDBG18629PPI
JCDBG19936JCDBG18419PPI
JCDBG19936JCDBG02680PPI
JCDBG19936JCDBG08042PPI
JCDBG00566JCDBG20116PPI
JCDBG23113JCDBG18419PPI
JCDBG23113JCDBG02680PPI
JCDBG23113JCDBG08042PPI
JCDBG23113JCDBG03587PPI
JCDBG23113JCDBG12412PPI
JCDBG09698JCDBG03587PPI
JCDBG22121JCDBG02680PPI
JCDBG22121JCDBG08042PPI
JCDBG18419JCDBG03587PPI
JCDBG20116JCDBG03587PPI
JCDBR00015
ID
JCDBR00015
Name
rps2
Type
protein_coding
Scaffold
NC_012224.1
Start
17086
End
17796
Strand
-
Exon
17086-17796
Sequence
AATGATAAGAAGATATTGGAACATTAATTTGGAAGAGATGATAAAAGCAGGAGTTCATTTTGGTCATGGTACTAGAAAAT GGAATCCGAGAATGGCACCTTATATCTCTGCAAAGCGTAAAGGTATTCATATTACAAATCTTACTAGAACTGCTCGTTTT TTATCAGAAGCTTGTGATTTAGTTTTTGATGCAGCAAGCAGGAGAAAACAATTCTTAATTGTTGGTACAAAAAATAAAGC AGCGGATTCAGTAGCGCGGGCTGCAATAAGGGCTCGGTGTCATTATGTTAATAAAAAATGGCTTGGCGGTATTTTAACGA ATTGGTCCACTACAGAAACTAGACTTCAAAAGTTCAGGGACTTGAGAATGGAACAAAAGGCAGGTAGACTCAACCGTCTT CCGAAAGGAGATGCGGCTCGATTGAAGAGACAGTTAGCTCACTTGCAAACATATCTGGGCGGGATTAAATATATGACGGG GTTACCGGATGTTGTAATAATCGTTGATCAGCAAGAGGAACATACGGCTCTTCGGGAATGTATCACTTTGGGAATTCCAA CGATTTGTTTAATTGATACAAACTGTGATCCGGATCTCGCAGATATTTCGATTCCAGCGAATGATGACGCTATAGCTTCA ATCCGATTAATTCTTAATAAATTAGTATTTGCAATTTGTGAAGGGCGTTCTAGCTATATACGAAATCCCTG
Product
Source
RefSeq
Link:
JCDBP00009
ID
JCDBP00009
Parent
JCDBR00015
Name
YP_002720101.1
Scaffold
NC_012224.1
CDS
17086-17796
Strand:
-
Sequence
MIRRYWNINLEEMIKAGVHFGHGTRKWNPRMAPYISAKRKGIHITNLTRTARFLSEACDLVFDAASRRKQFLIVGTKNKA ADSVARAAIRARCHYVNKKWLGGILTNWSTTETRLQKFRDLRMEQKAGRLNRLPKGDAARLKRQLAHLQTYLGGIKYMTG LPDVVIIVDQQEEHTALRECITLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP
Product
ribosomal protein S2
Source
RefSeq
Link
YP_002720101.1
InterProScan
IPR001865 Ribosomal protein S2
IPR005706 Ribosomal protein S2, bacteria/mitochondria/plastid
IPR018130 Ribosomal protein S2, conserved site
IPR023591 Ribosomal protein S2, flavodoxin-like domain
Pfam
PF00318.16 Ribosomal_S2 Family