Detail information of JCDBG00016

JCDBG00016
ID
JCDBG00016
Name
rpoC2
Type
protein_coding
Scaffold
NC_012224.1
Start
18069
End
22253
Strand
-
Link
Genbank id:7564838 | Jatropha Genome Database ID:Jcr4U29398.20
Molecular function
GO:0003899 | DNA-directed RNA polymerase activity
GO:0003677 | DNA binding
Cellular component
Biological process
GO:0006351 | transcription, DNA-templated
KEGG
Entry: K03046
Name: rpoC
Definition: DNA-directed RNA polymerase subunit beta' [EC:2.7.7.6]
ko00230:   Purine metabolism
ko00240:   Pyrimidine metabolism
ko03020:   RNA polymerase
Source
RefSeq
TF
Description
Sequence
TATGGAGGTGCTTATGGTCGAACGGGCCAGTCTGGTCTTTCACAATAAAGTGATAGATGGAACTGCCATTAAACGACTTA TTAGCAGATTAATAGATCATTTTGGAATGGCATATACATCACACATCCTGGATCAAGTAAAGACTCTGGGTTTCCAGCAA GCCACTGCTACATCCATTTCATTAGGAATTGATGATCTTTTAACAATACCTTCTAAGGGATGGCTAGTCCAAGATGCTGA ACAACAAAGTTTGATTTTGGAAAAACATTATCATTATGGAAATGTACACGTGGTAGAAAAATTACGCCAATCTATTGAGG TATGGTATGCTACAAGTGAATATTTGCGACAAGAAATGAATCTTAATTTTAGGATGACGGAACCCTTTAATCCAGTTCAT ATAATGTCTTTTTCGGGAGCTAGGGGAAATGCATCTCAAGTACACCAATTAGTAGGTATGAGAGGATTAATGTCGGATCC ACAAGGACAAATGATTGATTTACCCATTCAAAGCAATTTACGTGAAGGACTGTCTTTAACAGAATATATCATTTCTTGCT ATGGAGCCCGAAAAGGGGTTGTCGATACTGCTGTACGAACATCAGATGCTGGATATCTTACACGTAGACTTGTTGAAGTA GTTCAACATATTGTTGTGCGTAGAACAGATTGTGGCACCACCCGAGGGATCTCCGTGAGTCCTCGAAATGGGACGATGTC GGAAAGGATTTTTATTCAAACATTAATTGGTCGTGTATTAGCAGACAATATATATATGGGTTTACGATGCATTGCCGTTC AAAATCAAGATATTGGGATTGGACTTGCCAATCGATTCATAACCTTTCGAACACAAACAATATCTATTCGAACTCCCTTT ACTTGTAGGAGTATGTCTTGGATCTGTCGATTATGTTATGGTCGGAGTCCTACTCATGGCGATCTAGTGGAATTGGGAGA AGCCGTAGGTATTATTGCAGGTCAATCCATTGGAGAGCCGGGTACTCAACTAACATTAAGAACGTTTCATACCGGCGGAG TATTCACAGGGGGTACTGCAGAACATGTGCGAGCCCCCTCTAATGGAAAAATCAAATTTAATGAGGATTTTGTTCATCCC ATACGTACACGTCATGGGCATCCTGCTTTTCTATGTTATATAGACTTGTATGTAACTATTGAGAGTCAAGATATTATACA TAACGTGACTATTCCACCAAAAAGTTTCCTTTTAGTTCAAAATGATCAATATGTAGAATCAGAACAAGTGATTGCTGAAA TTCGGGCGGGAACATACACTTTGAATTTTAAAGAGAAGGTTCGAAAACATATTTATTCCGATTCAGAAGGGGAAATGCAC TGGAGTTCTGATGTATACCACGCACCTGAATTTACATATAGTAATGTCCATCTCTTACCAAAAACAAGCCATTTATGGAT ATTATCGGGAAGTTCGTGCAGATCCAGTATAGTTCCTTTTTCACTACACAAGGATCAAGATCAAATGAACGTTCATTCTA TTTCTGTCAAAAGAAGATATATTTCTAGTCTTTCTGTAAATAATGATCAAGTTAAACACAAATTCATTAGTTCAGATTTT TCGGGTAAAAAAGAAAGTAAGATTCCTGATTATTCAGAACTTAATCGAATCATATGTACTGGTCATTGTAATCTCATATA TTCTGCTATTCTCTACGAGAATTCTGATTTATTGGCAAAGAGGCGAAGAAATAAATTCATCATCCCATTCCAATCAATTC AAGAACGAGAGAAAGAACTAATGACCCACTCCGCTATCTCGATTGAAATACCTAGAAATGGTATTTTCCGTAGAAATAGT GTTTTTGCTTATTTCGACGATCCCCAATACCGAAGAAAGAGTTCAGGAATTACTAAATCAGGAATTACTAAATATGGGAC TATAGGAGTGCATTCAATCGTCAAAAAAGAGGATTTGATTGAGTATCGGGGAGTCAAAGAATTTAAGCCAAAATACCAAA TGAAAGTGGATCGCTTTTTTTTCATTCCCGAGGAAGTGTATATTTTCCCCGAATCTTCTTCCCTAATGGTACGGAACAAT AGTATCATTGGAGTAGATACACAAATTGCTTTAAATACAAGAAGTCGAGTGGGCGGGTTGGTCCGAGTGGAGAGAAAAAA AAAAAAAATGGAACTTAAAATCTTTTCTGGAGATATCCATTTTCCGGGAGAGACAGATAAGATATCCCGACACAGCGGTA TCTTGATACCACCAGGAACGGTAAAAACAAATTCTAAGGAATCAAAAAAAGTGAAAAATTGGATCTATATCCAACGAATC ACATCCGCCAAGAAAAAGTATTTTGTTTTGGTTCGACCAGTAATCATATATGAGATAGCGGACGGTATAAATTTAGAAAC ACTTTTCCCCCAGGATCTATTGCAGGAAAAAGAGAATCTGAAACTTCGAGTTGTCAATTATATTCTTTATGGAAATGGTA AACTAATTCGGGGAATTTCTGACACAAGTATTCAATTAGTTCGTACTTGTTTAGTGTTGAATTGGGACCAAGACAAAAAA AGTTCTTCTATCGAAGAGGCTCGCGCTTCTTTTGTTGAAGTAAGCACAAACGGTCTAATTTGTGATTTCCTAAGAATCAA CCTAGCGAAATCCCATATTTCATATATCAGTAGAAAAAGGAATGATCCATCAGGTTCAGGACCGATCTCTAATAATGAGT CAGATCGAACCAATATTAATCCATTTTATCCCATTTATTCCAAGACAAGGATTCAACAATCACTTAAACAAAATCAAGGA ACTATTAGTACGTTGTTGAATAGAAATAAGGAATGTCAATCTTTGATAATTTTGTCATCATCTAATTGTTTTCGAATGGA TCCATTCAGCGATGCAAAACATCACAATGTAATAAAAGAATCAATTAAAAGAGATCCTATACCTATAATTCCAATTAGAA ATTCATTGGGCCCTGTAGGAACAGCCCTTCCAATTGCGAATTTTTATTTATTTTACCTAATATTAATAACTCATAATCAG GTCTCGTTAACTAAATATTGGAAACTTGACAATTTAAAACAGACTTTTCAAGTACTTAAATATTATTTAATGGACGAAAA CGGGAGAATTGTTAATCCTGATTCATGCAGTAACAGCGTTTTGAATCCATTCAATTTGAATTGGTATTTTCTCCATCATA ATTATTATCATAATTTTTGTGAAGAAAGATTTACAACAATTAGCCTGGGACAGTTTATTTGTGAAAATGTATGTATGGCC AAAAACGGACCCCATCTAAAATCGGGTCAAGTTATAATTGTTCGCATGGACTCGGTAGTAATACGATCAGCAAAGCCCTA TTTGGCCGCTCCAGGAGCAACCGTTCATGGCCATTATGGAGAAATCTTTTACGAAGGAGATACATTAGTTACATTTTTAT ATGAAAAATCGAGATCTGGTGATATAACGCAGGGTCTTCCAAAAGTGGAACAAGTGTTAGAAGTGCGCTCAATTGATTCA ATATCGATAAGCCTAGAAAAGAGAGTTGAGGGTTGGAACGAGTGTATAACAAGAATTCTTGGAATTCCTTGGGGATTCTT GATTGGTGCTGAACTAACTATAGTGCAAAGTCGTATCTCTTTGGTTAATAAGATTCAAAAGGTTTATCGATCCCAAGGAG TGCAGATACATAATAGGCATATAGAAATTATTGTACGTCAAATAACATCCAAAGTTTTGGTTTCAGAAGACGGAATGTCA AATGTTTTTTCACCCGGAGAACTAATTGGATTGTTGCGAGCGGAACGAACGGGACGCGCTTTAGAAGAAGCCATCTGTTA TCGAGCCATATTATTAGGAATAACGAGAGCATCTCTGAATACTCAAAGTTTCATATCCGAGGCCAGTTTTCAAGAAACTG CTCGCGTTTTAGCAAAAGCCGCTCTCCGCGGTCGTATCGATTGGTTGAAAGGCCTGAAAGAAAACGTTGTTCTAGGTGGT ATGATACCCGGTGGTACCGGATTCAAAGGATTAGTGCAAGGCTCAAGGCAACATAATAACATTCCTTTGAAAACCAAAAA GAAGAATTTATTCGAGGGGGAATTTAGAGATAGAGATATTTTATTCCACCACAGAGAGTTATTTGATTCTTGCATTTCAA AAAATTTCTATGATACAGCAAAATA
Gene structure

JCDB Genes gff download

JCDBG00016 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00016's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00016JCDBG00015co-exp0.940419
JCDBG00016JCDBG00074co-exp0.898756
JCDBG00016JCDBG00076co-exp0.885852
JCDBG00016JCDBG00014co-exp0.880861
JCDBG00016JCDBG00017co-exp0.87755
JCDBG00016JCDBG00042co-exp0.87673
JCDBG00016JCDBG00100co-exp0.848717
JCDBG00016JCDBG00073co-exp0.842042
JCDBG00016JCDBG00018co-exp0.816014
JCDBG00016JCDBG00066co-exp0.814743
JCDBG00015JCDBG00074co-exp0.915663
JCDBG00015JCDBG00076co-exp0.930852
JCDBG00015JCDBG00014co-exp0.962428
JCDBG00015JCDBG00017co-exp0.837062
JCDBG00015JCDBG00042co-exp0.895991
JCDBG00015JCDBG00100co-exp0.823086
JCDBG00015JCDBG00073co-exp0.832888
JCDBG00015JCDBG00018co-exp0.665631
JCDBG00015JCDBG00066co-exp0.817076
JCDBG00074JCDBG00076co-exp0.954077
JCDBG00074JCDBG00014co-exp0.908064
JCDBG00074JCDBG00017co-exp0.864342
JCDBG00074JCDBG00042co-exp0.855675
JCDBG00074JCDBG00100co-exp0.80827
JCDBG00074JCDBG00073co-exp0.919097
JCDBG00074JCDBG00018co-exp0.681671
JCDBG00074JCDBG00066co-exp0.812118
JCDBG00076JCDBG00014co-exp0.927644
JCDBG00076JCDBG00017co-exp0.827276
JCDBG00076JCDBG00042co-exp0.878569
JCDBG00076JCDBG00100co-exp0.852873
JCDBG00076JCDBG00073co-exp0.907254
JCDBG00076JCDBG00018co-exp0.649689
JCDBG00076JCDBG00066co-exp0.790643
JCDBG00014JCDBG00017co-exp0.844381
JCDBG00014JCDBG00042co-exp0.895739
JCDBG00014JCDBG00100co-exp0.790546
JCDBG00014JCDBG00073co-exp0.847308
JCDBG00014JCDBG00066co-exp0.856988
JCDBG00017JCDBG00042co-exp0.821724
JCDBG00017JCDBG00100co-exp0.742444
JCDBG00017JCDBG00073co-exp0.843437
JCDBG00017JCDBG00018co-exp0.785792
JCDBG00017JCDBG00066co-exp0.924073
JCDBG00042JCDBG00100co-exp0.91609
JCDBG00042JCDBG00073co-exp0.877775
JCDBG00042JCDBG00018co-exp0.786843
JCDBG00042JCDBG00066co-exp0.761356
JCDBG00100JCDBG00073co-exp0.863882
JCDBG00100JCDBG00018co-exp0.814589
JCDBG00100JCDBG00066co-exp0.635237
JCDBG00073JCDBG00018co-exp0.751791
JCDBG00073JCDBG00066co-exp0.745586
JCDBG00018JCDBG00066co-exp0.640891
PPI network
node1node2type
JCDBR00016
ID
JCDBR00016
Name
rpoC2
Type
protein_coding
Scaffold
NC_012224.1
Start
18069
End
22253
Strand
-
Exon
18069-22253
Sequence
TATGGAGGTGCTTATGGTCGAACGGGCCAGTCTGGTCTTTCACAATAAAGTGATAGATGGAACTGCCATTAAACGACTTA TTAGCAGATTAATAGATCATTTTGGAATGGCATATACATCACACATCCTGGATCAAGTAAAGACTCTGGGTTTCCAGCAA GCCACTGCTACATCCATTTCATTAGGAATTGATGATCTTTTAACAATACCTTCTAAGGGATGGCTAGTCCAAGATGCTGA ACAACAAAGTTTGATTTTGGAAAAACATTATCATTATGGAAATGTACACGTGGTAGAAAAATTACGCCAATCTATTGAGG TATGGTATGCTACAAGTGAATATTTGCGACAAGAAATGAATCTTAATTTTAGGATGACGGAACCCTTTAATCCAGTTCAT ATAATGTCTTTTTCGGGAGCTAGGGGAAATGCATCTCAAGTACACCAATTAGTAGGTATGAGAGGATTAATGTCGGATCC ACAAGGACAAATGATTGATTTACCCATTCAAAGCAATTTACGTGAAGGACTGTCTTTAACAGAATATATCATTTCTTGCT ATGGAGCCCGAAAAGGGGTTGTCGATACTGCTGTACGAACATCAGATGCTGGATATCTTACACGTAGACTTGTTGAAGTA GTTCAACATATTGTTGTGCGTAGAACAGATTGTGGCACCACCCGAGGGATCTCCGTGAGTCCTCGAAATGGGACGATGTC GGAAAGGATTTTTATTCAAACATTAATTGGTCGTGTATTAGCAGACAATATATATATGGGTTTACGATGCATTGCCGTTC AAAATCAAGATATTGGGATTGGACTTGCCAATCGATTCATAACCTTTCGAACACAAACAATATCTATTCGAACTCCCTTT ACTTGTAGGAGTATGTCTTGGATCTGTCGATTATGTTATGGTCGGAGTCCTACTCATGGCGATCTAGTGGAATTGGGAGA AGCCGTAGGTATTATTGCAGGTCAATCCATTGGAGAGCCGGGTACTCAACTAACATTAAGAACGTTTCATACCGGCGGAG TATTCACAGGGGGTACTGCAGAACATGTGCGAGCCCCCTCTAATGGAAAAATCAAATTTAATGAGGATTTTGTTCATCCC ATACGTACACGTCATGGGCATCCTGCTTTTCTATGTTATATAGACTTGTATGTAACTATTGAGAGTCAAGATATTATACA TAACGTGACTATTCCACCAAAAAGTTTCCTTTTAGTTCAAAATGATCAATATGTAGAATCAGAACAAGTGATTGCTGAAA TTCGGGCGGGAACATACACTTTGAATTTTAAAGAGAAGGTTCGAAAACATATTTATTCCGATTCAGAAGGGGAAATGCAC TGGAGTTCTGATGTATACCACGCACCTGAATTTACATATAGTAATGTCCATCTCTTACCAAAAACAAGCCATTTATGGAT ATTATCGGGAAGTTCGTGCAGATCCAGTATAGTTCCTTTTTCACTACACAAGGATCAAGATCAAATGAACGTTCATTCTA TTTCTGTCAAAAGAAGATATATTTCTAGTCTTTCTGTAAATAATGATCAAGTTAAACACAAATTCATTAGTTCAGATTTT TCGGGTAAAAAAGAAAGTAAGATTCCTGATTATTCAGAACTTAATCGAATCATATGTACTGGTCATTGTAATCTCATATA TTCTGCTATTCTCTACGAGAATTCTGATTTATTGGCAAAGAGGCGAAGAAATAAATTCATCATCCCATTCCAATCAATTC AAGAACGAGAGAAAGAACTAATGACCCACTCCGCTATCTCGATTGAAATACCTAGAAATGGTATTTTCCGTAGAAATAGT GTTTTTGCTTATTTCGACGATCCCCAATACCGAAGAAAGAGTTCAGGAATTACTAAATCAGGAATTACTAAATATGGGAC TATAGGAGTGCATTCAATCGTCAAAAAAGAGGATTTGATTGAGTATCGGGGAGTCAAAGAATTTAAGCCAAAATACCAAA TGAAAGTGGATCGCTTTTTTTTCATTCCCGAGGAAGTGTATATTTTCCCCGAATCTTCTTCCCTAATGGTACGGAACAAT AGTATCATTGGAGTAGATACACAAATTGCTTTAAATACAAGAAGTCGAGTGGGCGGGTTGGTCCGAGTGGAGAGAAAAAA AAAAAAAATGGAACTTAAAATCTTTTCTGGAGATATCCATTTTCCGGGAGAGACAGATAAGATATCCCGACACAGCGGTA TCTTGATACCACCAGGAACGGTAAAAACAAATTCTAAGGAATCAAAAAAAGTGAAAAATTGGATCTATATCCAACGAATC ACATCCGCCAAGAAAAAGTATTTTGTTTTGGTTCGACCAGTAATCATATATGAGATAGCGGACGGTATAAATTTAGAAAC ACTTTTCCCCCAGGATCTATTGCAGGAAAAAGAGAATCTGAAACTTCGAGTTGTCAATTATATTCTTTATGGAAATGGTA AACTAATTCGGGGAATTTCTGACACAAGTATTCAATTAGTTCGTACTTGTTTAGTGTTGAATTGGGACCAAGACAAAAAA AGTTCTTCTATCGAAGAGGCTCGCGCTTCTTTTGTTGAAGTAAGCACAAACGGTCTAATTTGTGATTTCCTAAGAATCAA CCTAGCGAAATCCCATATTTCATATATCAGTAGAAAAAGGAATGATCCATCAGGTTCAGGACCGATCTCTAATAATGAGT CAGATCGAACCAATATTAATCCATTTTATCCCATTTATTCCAAGACAAGGATTCAACAATCACTTAAACAAAATCAAGGA ACTATTAGTACGTTGTTGAATAGAAATAAGGAATGTCAATCTTTGATAATTTTGTCATCATCTAATTGTTTTCGAATGGA TCCATTCAGCGATGCAAAACATCACAATGTAATAAAAGAATCAATTAAAAGAGATCCTATACCTATAATTCCAATTAGAA ATTCATTGGGCCCTGTAGGAACAGCCCTTCCAATTGCGAATTTTTATTTATTTTACCTAATATTAATAACTCATAATCAG GTCTCGTTAACTAAATATTGGAAACTTGACAATTTAAAACAGACTTTTCAAGTACTTAAATATTATTTAATGGACGAAAA CGGGAGAATTGTTAATCCTGATTCATGCAGTAACAGCGTTTTGAATCCATTCAATTTGAATTGGTATTTTCTCCATCATA ATTATTATCATAATTTTTGTGAAGAAAGATTTACAACAATTAGCCTGGGACAGTTTATTTGTGAAAATGTATGTATGGCC AAAAACGGACCCCATCTAAAATCGGGTCAAGTTATAATTGTTCGCATGGACTCGGTAGTAATACGATCAGCAAAGCCCTA TTTGGCCGCTCCAGGAGCAACCGTTCATGGCCATTATGGAGAAATCTTTTACGAAGGAGATACATTAGTTACATTTTTAT ATGAAAAATCGAGATCTGGTGATATAACGCAGGGTCTTCCAAAAGTGGAACAAGTGTTAGAAGTGCGCTCAATTGATTCA ATATCGATAAGCCTAGAAAAGAGAGTTGAGGGTTGGAACGAGTGTATAACAAGAATTCTTGGAATTCCTTGGGGATTCTT GATTGGTGCTGAACTAACTATAGTGCAAAGTCGTATCTCTTTGGTTAATAAGATTCAAAAGGTTTATCGATCCCAAGGAG TGCAGATACATAATAGGCATATAGAAATTATTGTACGTCAAATAACATCCAAAGTTTTGGTTTCAGAAGACGGAATGTCA AATGTTTTTTCACCCGGAGAACTAATTGGATTGTTGCGAGCGGAACGAACGGGACGCGCTTTAGAAGAAGCCATCTGTTA TCGAGCCATATTATTAGGAATAACGAGAGCATCTCTGAATACTCAAAGTTTCATATCCGAGGCCAGTTTTCAAGAAACTG CTCGCGTTTTAGCAAAAGCCGCTCTCCGCGGTCGTATCGATTGGTTGAAAGGCCTGAAAGAAAACGTTGTTCTAGGTGGT ATGATACCCGGTGGTACCGGATTCAAAGGATTAGTGCAAGGCTCAAGGCAACATAATAACATTCCTTTGAAAACCAAAAA GAAGAATTTATTCGAGGGGGAATTTAGAGATAGAGATATTTTATTCCACCACAGAGAGTTATTTGATTCTTGCATTTCAA AAAATTTCTATGATACAGCAAAATA
Product
Source
RefSeq
Link:
JCDBP00010
ID
JCDBP00010
Parent
JCDBR00016
Name
YP_002720102.1
Scaffold
NC_012224.1
CDS
18069-22253
Strand:
-
Sequence
MEVLMVERASLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTIPSKGWLVQDAE QQSLILEKHYHYGNVHVVEKLRQSIEVWYATSEYLRQEMNLNFRMTEPFNPVHIMSFSGARGNASQVHQLVGMRGLMSDP QGQMIDLPIQSNLREGLSLTEYIISCYGARKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTTRGISVSPRNGTMS ERIFIQTLIGRVLADNIYMGLRCIAVQNQDIGIGLANRFITFRTQTISIRTPFTCRSMSWICRLCYGRSPTHGDLVELGE AVGIIAGQSIGEPGTQLTLRTFHTGGVFTGGTAEHVRAPSNGKIKFNEDFVHPIRTRHGHPAFLCYIDLYVTIESQDIIH NVTIPPKSFLLVQNDQYVESEQVIAEIRAGTYTLNFKEKVRKHIYSDSEGEMHWSSDVYHAPEFTYSNVHLLPKTSHLWI LSGSSCRSSIVPFSLHKDQDQMNVHSISVKRRYISSLSVNNDQVKHKFISSDFSGKKESKIPDYSELNRIICTGHCNLIY SAILYENSDLLAKRRRNKFIIPFQSIQEREKELMTHSAISIEIPRNGIFRRNSVFAYFDDPQYRRKSSGITKSGITKYGT IGVHSIVKKEDLIEYRGVKEFKPKYQMKVDRFFFIPEEVYIFPESSSLMVRNNSIIGVDTQIALNTRSRVGGLVRVERKK KKMELKIFSGDIHFPGETDKISRHSGILIPPGTVKTNSKESKKVKNWIYIQRITSAKKKYFVLVRPVIIYEIADGINLET LFPQDLLQEKENLKLRVVNYILYGNGKLIRGISDTSIQLVRTCLVLNWDQDKKSSSIEEARASFVEVSTNGLICDFLRIN LAKSHISYISRKRNDPSGSGPISNNESDRTNINPFYPIYSKTRIQQSLKQNQGTISTLLNRNKECQSLIILSSSNCFRMD PFSDAKHHNVIKESIKRDPIPIIPIRNSLGPVGTALPIANFYLFYLILITHNQVSLTKYWKLDNLKQTFQVLKYYLMDEN GRIVNPDSCSNSVLNPFNLNWYFLHHNYYHNFCEERFTTISLGQFICENVCMAKNGPHLKSGQVIIVRMDSVVIRSAKPY LAAPGATVHGHYGEIFYEGDTLVTFLYEKSRSGDITQGLPKVEQVLEVRSIDSISISLEKRVEGWNECITRILGIPWGFL IGAELTIVQSRISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVSEDGMSNVFSPGELIGLLRAERTGRALEEAICY RAILLGITRASLNTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPGGTGFKGLVQGSRQHNNIPLKTKK KNLFEGEFRDRDILFHHRELFDSCISKNFYDTAK
Product
RNA polymerase beta'' subunit
Source
RefSeq
Link
YP_002720102.1
InterProScan
IPR007066 RNA polymerase Rpb1, domain 3
IPR007081 RNA polymerase Rpb1, domain 5
IPR007083 RNA polymerase Rpb1, domain 4
IPR012756 DNA-directed RNA polymerase, subunit beta''
Pfam
PF04983.14 RNA_pol_Rpb1_3 Domain
PF05000.13 RNA_pol_Rpb1_4 Domain
PF04998.13 RNA_pol_Rpb1_5 Domain
PF04998.13 RNA_pol_Rpb1_5 Domain