Detail information of JCDBG00017

JCDBG00017
ID
JCDBG00017
Name
rpoC1
Type
protein_coding
Scaffold
NC_012224.1
Start
22413
End
25235
Strand
-
Link
Genbank id:7564839 | Jatropha Genome Database ID:Jcr4S02936.20
Molecular function
GO:0003899 | DNA-directed RNA polymerase activity
GO:0003677 | DNA binding
Cellular component
Biological process
GO:0006351 | transcription, DNA-templated
KEGG
Entry: K03046
Name: rpoC
Definition: DNA-directed RNA polymerase subunit beta' [EC:2.7.7.6]
ko00230:   Purine metabolism
ko00240:   Pyrimidine metabolism
ko03020:   RNA polymerase
Source
RefSeq
TF
Description
Sequence
TATGATTGATCGGTATAAACATCAACAACTCCGAATTGGATCAGTTTCGCCTCAACAAATAAGTGCTTGGGCCAATAAAA TCCTACCTAACGGAGAGATTGTTGGAGAGGTGACAAAACCCTATACTTTTCATTACAAAACCAATAAACCTGAAAAAGAT GGATTATTTTGTGAAAGAATTTTTGGGCCTATAAAAAGTGGAATTTGTGCTTGTGGAAATTATCGAGTAATCAGAAATGA AAAAGAAGACCCAAAATTTTGTGAACAATGCGGAGTCGAGTTTGTTGATTCTCGGATACGAAGATATCAAATGGGCTACA TCAAACTGGCATGCCCAGTAACTCATGTGTGGTATTTGAAACGTCTTCCTAGTTATATCGCAAATCTTTTAGATAAACCT CTTAAAGAATTAGAGGGCCTAGTATACTGCGATGTGTGATTTGATCGAAATTCTGATTTTACAGTTTTGGAATGAAAAAC TGTCATCCCATTTAATCGAATTGGGATGCCCCGGACCTGACATGTCGCTTGAAAGGAGTAACATGAAGCTCAGAATTATG GGTGTATTCAATACCCCCCAATAAAAGAGGAATTGGTCTATGGTCGATGCAGAAACAAATAAATAGGAATTCCTAGTTGT ATCTCGTGAAAACCGACTTCTTTCTTTTGCTTTTGTGGAATTAATCATTCCCTTTCTTTTTTTTTTAGAAAAAAAAGAAA CTATGTTTATACTCAAGTAAGCAAATATGTCATGGTTAAAGAAGTCTATACATCGCATATAGGCTTTAATGGCATCGTGG CATAACCGTCGAGGTGAGTTCGGGACCCAAAAGATCGAATAGAAAGAGACATAGACAAGTAAATCCCTTATGAATTCTAA GGTACTGGGAATTCATCATTCGAAGGGAAGTAGACTACTCAAGAATTTCACATTTCATTTAAGTCGTAATTGTGAGAATT GAATAAGTTGTGATAATTAAATAAAGAATTCAGAAATTCTAAAAAAAAATGGAAAAGAAGAATGAATCAATGAAAGCTTG CTTGGTATTCATCGGGAACTTGAGTAAGGAGTAGCTCTTTTGGGGGTTTTTCTCGATTTTGAAAGCAGGAACGAACCCCC TTTTTTTATTTGGTATAACTACTGGAGCCGGATGAGAGGAAACTTTCACGTCCGATTTTGAAGGGGGGAGACCCTATAGG ATCCTATCCCAATTTTTCTTTTGCTAGGCCCATAGCTAAAAAACCCACTTTTTTACGATTACGAGGTTCATTCGAATATG AAATCCAATCTTGGAAATACAGTATTCCACTTTTTTTTACTACCCAAGGCTTCGATACATTTCGAAATCGAGAAATTTCT ACAGGAGCTGGTGCTATCCGAGAACAATTAGCCGATCTGGATTTGCGAATTATTATAGATTATTCATCGGTAGAATGGAA AGAATTAGGGGAAGAAGGGCCTACAGGGAATGAATGGGAAGATCGAAAAGTTGGAAGAAGAAAGGATTTTTTGGTTAGAC GCGTGGAATTAGCTAAGCATTTTATTCGAACAAATATAGAACCAGAATGGATGGTTTTATGTCTATTACCGGTTCTTCCT CCCGAGTTGAGACCAATCATTCAGATAGATGGGGGTAAACTAATGAGTTCAGATATTAATGAACTCTATAGAAGAGTTAT CTATCGGAACAATACTCTTATTGATCTATTAACAACAAGTAGATCTACGCCAGGGGAATTAGTAATGTGTCAGGAGAAAT TGGTACAAGAAGCCGTGGATACACTTCTTGATAATGGAATCCGCGGACAACCTATGAGGGACGGTCATAATAAGGTTTAC AAGTCGTTTTCGGATGTAATTGAAGGCAAAGAAGGAAGATTTCGTGAGACTATGCTTGGCAAACGGGTTGATTATTCGGG GCGTTCTGTCATTGTCGTAGGCCCCTCACTTTCATTACATCGATGTGGATTGCCTCGCGAAATAGCAATAGAGCTTTTCC AGATATTTGTAATTCGTGGTCTAATTAGGCAACATCTTGCTTCGAACATAGGAGTTGCTAAGAGTAAAATTCGGGAAAAA GAACCAATTGTATGGGAAATACTTCAAGAAGTTATGCAGGGACATCCGGTATTACTGAATAGAGCGCCGACTCTGCATAG ATTAGGCATACAGGCGTTCCAACCCATTTTAGTGGAAGGCCGTGCTATTTGTTTACATCCATTGGTTTGTAAGGGATTCA ATGCAGACTTTGATGGGGATCAAATGGCTGTTCATGTACCTTTATCGTTGGAGGCTCAAACAGAGGCTCGTTTACTTATG TTTTCTCATATGAATCTCTTGTCTCCAGCTATTGGAGATCCCATCTCCGTACCAACTCAAGATATGCTTATTGGGCTCTA TGTATTAACAAGCGGGAATCGTCGAGGTATTTGTGCAAATAGGTATAATCCATGTAATCGCAGAAATTCTCAAAATGAAA GAATTGACGATAATAACAATAAATATACGAAAGAACCTTTTTTTTCTAATTCTTATGATGCAATTGGCGCTTTTCGGCGG AAAAGAATCAATTTAGATAGCCCTTTGTGGCTCCGGTGGCAACTAGATCAACGCGCTATTGTTTCAAGAGAAGCTCCCCT CGAAGTTCACTATGAATCTTTAGGTACCTATCATGAGATTTATGAACACTATCTAATAGTAAGAAATATAAAAAAAGAAA TTATTTGTATATACATTCGAACTACTGTTGGTCATATTTCTTTTTATCGAGAAATCGAAGAAGCTATACAAGGGTTTTGT CAAGCCTGCTCAGATGGTATCTA
Gene structure

JCDB Genes gff download

JCDBG00017 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00017's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00017JCDBG00066co-exp0.924073
JCDBG00017JCDBG00016co-exp0.87755
JCDBG00017JCDBG00074co-exp0.864342
JCDBG00017JCDBG00014co-exp0.844381
JCDBG00017JCDBG00073co-exp0.843437
JCDBG00017JCDBG00015co-exp0.837062
JCDBG00017JCDBG00076co-exp0.827276
JCDBG00017JCDBG00042co-exp0.821724
JCDBG00017JCDBG00122co-exp0.805024
JCDBG00017JCDBG00103co-exp0.787108
JCDBG00066JCDBG00016co-exp0.814743
JCDBG00066JCDBG00074co-exp0.812118
JCDBG00066JCDBG00014co-exp0.856988
JCDBG00066JCDBG00073co-exp0.745586
JCDBG00066JCDBG00015co-exp0.817076
JCDBG00066JCDBG00076co-exp0.790643
JCDBG00066JCDBG00042co-exp0.761356
JCDBG00066JCDBG00122co-exp0.749835
JCDBG00066JCDBG00103co-exp0.80025
JCDBG00016JCDBG00074co-exp0.898756
JCDBG00016JCDBG00014co-exp0.880861
JCDBG00016JCDBG00073co-exp0.842042
JCDBG00016JCDBG00015co-exp0.940419
JCDBG00016JCDBG00076co-exp0.885852
JCDBG00016JCDBG00042co-exp0.87673
JCDBG00016JCDBG00122co-exp0.687024
JCDBG00016JCDBG00103co-exp0.779471
JCDBG00074JCDBG00014co-exp0.908064
JCDBG00074JCDBG00073co-exp0.919097
JCDBG00074JCDBG00015co-exp0.915663
JCDBG00074JCDBG00076co-exp0.954077
JCDBG00074JCDBG00042co-exp0.855675
JCDBG00074JCDBG00122co-exp0.763418
JCDBG00074JCDBG00103co-exp0.74983
JCDBG00014JCDBG00073co-exp0.847308
JCDBG00014JCDBG00015co-exp0.962428
JCDBG00014JCDBG00076co-exp0.927644
JCDBG00014JCDBG00042co-exp0.895739
JCDBG00014JCDBG00122co-exp0.645464
JCDBG00014JCDBG00103co-exp0.803491
JCDBG00073JCDBG00015co-exp0.832888
JCDBG00073JCDBG00076co-exp0.907254
JCDBG00073JCDBG00042co-exp0.877775
JCDBG00073JCDBG00122co-exp0.764449
JCDBG00073JCDBG00103co-exp0.626525
JCDBG00015JCDBG00076co-exp0.930852
JCDBG00015JCDBG00042co-exp0.895991
JCDBG00015JCDBG00122co-exp0.616083
JCDBG00015JCDBG00103co-exp0.826044
JCDBG00076JCDBG00042co-exp0.878569
JCDBG00076JCDBG00122co-exp0.687073
JCDBG00076JCDBG00103co-exp0.754901
JCDBG00042JCDBG00122co-exp0.644414
JCDBG00042JCDBG00103co-exp0.774638
PPI network
node1node2type
JCDBG00017JCDBG24182PPI
JCDBG00017JCDBG11462PPI
JCDBG00017JCDBG07926PPI
JCDBG00017JCDBG15890PPI
JCDBG00017JCDBG24664PPI
JCDBG00017JCDBG17434PPI
JCDBG00017JCDBG21369PPI
JCDBG00017JCDBG03004PPI
JCDBG00017JCDBG18937PPI
JCDBG00017JCDBG23880PPI
JCDBG00017JCDBG15243PPI
JCDBG00017JCDBG13802PPI
JCDBG00017JCDBG10704PPI
JCDBG00017JCDBG23997PPI
JCDBG00017JCDBG09234PPI
JCDBG00017JCDBG23469PPI
JCDBG00017JCDBG08044PPI
JCDBG00017JCDBG23088PPI
JCDBG00017JCDBG09503PPI
JCDBG00017JCDBG03611PPI
JCDBG00017JCDBG21164PPI
JCDBG00017JCDBG17129PPI
JCDBG00017JCDBG15143PPI
JCDBG00017JCDBG16262PPI
JCDBG00017JCDBG06148PPI
JCDBG00017JCDBG18679PPI
JCDBG00017JCDBG00558PPI
JCDBG00017JCDBG07506PPI
JCDBG00017JCDBG15223PPI
JCDBG00017JCDBG03609PPI
JCDBG00017JCDBG04352PPI
JCDBG00017JCDBG07435PPI
JCDBG00017JCDBG09074PPI
JCDBG00017JCDBG09453PPI
JCDBG00017JCDBG19936PPI
JCDBG00017JCDBG14334PPI
JCDBG00017JCDBG18629PPI
JCDBG00017JCDBG12398PPI
JCDBG00017JCDBG08109PPI
JCDBG00017JCDBG22121PPI
JCDBG00017JCDBG06075PPI
JCDBG00017JCDBG18419PPI
JCDBG00017JCDBG19616PPI
JCDBG00017JCDBG08310PPI
JCDBG00017JCDBG11820PPI
JCDBG00017JCDBG20886PPI
JCDBG24182JCDBG17434PPI
JCDBG24182JCDBG21369PPI
JCDBG24182JCDBG23880PPI
JCDBG24182JCDBG13802PPI
JCDBG24182JCDBG23997PPI
JCDBG24182JCDBG09234PPI
JCDBG24182JCDBG23469PPI
JCDBG24182JCDBG08044PPI
JCDBG24182JCDBG17129PPI
JCDBG24182JCDBG06148PPI
JCDBG24182JCDBG00558PPI
JCDBG24182JCDBG07506PPI
JCDBG24182JCDBG19936PPI
JCDBG24182JCDBG12398PPI
JCDBG24182JCDBG08109PPI
JCDBG24182JCDBG18419PPI
JCDBG11462JCDBG23088PPI
JCDBG07926JCDBG23880PPI
JCDBG07926JCDBG06148PPI
JCDBG15890JCDBG24664PPI
JCDBG15890JCDBG03004PPI
JCDBG15890JCDBG18937PPI
JCDBG15890JCDBG03611PPI
JCDBG15890JCDBG21164PPI
JCDBG15890JCDBG18679PPI
JCDBG15890JCDBG03609PPI
JCDBG15890JCDBG09453PPI
JCDBG15890JCDBG08109PPI
JCDBG15890JCDBG20886PPI
JCDBG24664JCDBG17434PPI
JCDBG24664JCDBG23880PPI
JCDBG24664JCDBG23997PPI
JCDBG24664JCDBG09234PPI
JCDBG24664JCDBG23469PPI
JCDBG24664JCDBG08310PPI
JCDBG17434JCDBG03004PPI
JCDBG17434JCDBG23880PPI
JCDBG17434JCDBG23469PPI
JCDBG17434JCDBG06148PPI
JCDBG17434JCDBG07506PPI
JCDBG17434JCDBG15223PPI
JCDBG17434JCDBG19936PPI
JCDBG17434JCDBG08109PPI
JCDBG17434JCDBG06075PPI
JCDBG17434JCDBG18419PPI
JCDBG21369JCDBG23880PPI
JCDBG21369JCDBG09234PPI
JCDBG21369JCDBG09074PPI
JCDBG21369JCDBG14334PPI
JCDBG21369JCDBG08109PPI
JCDBG03004JCDBG23997PPI
JCDBG03004JCDBG23469PPI
JCDBG03004JCDBG03611PPI
JCDBG03004JCDBG21164PPI
JCDBG03004JCDBG06148PPI
JCDBG03004JCDBG18679PPI
JCDBG03004JCDBG03609PPI
JCDBG03004JCDBG22121PPI
JCDBG18937JCDBG10704PPI
JCDBG18937JCDBG23088PPI
JCDBG18937JCDBG16262PPI
JCDBG18937JCDBG06148PPI
JCDBG18937JCDBG07506PPI
JCDBG18937JCDBG08109PPI
JCDBG18937JCDBG18419PPI
JCDBG23880JCDBG15243PPI
JCDBG23880JCDBG13802PPI
JCDBG23880JCDBG23997PPI
JCDBG23880JCDBG23469PPI
JCDBG23880JCDBG08044PPI
JCDBG23880JCDBG17129PPI
JCDBG23880JCDBG06148PPI
JCDBG23880JCDBG00558PPI
JCDBG23880JCDBG07506PPI
JCDBG23880JCDBG04352PPI
JCDBG23880JCDBG19936PPI
JCDBG23880JCDBG08109PPI
JCDBG23880JCDBG08310PPI
JCDBG15243JCDBG23469PPI
JCDBG15243JCDBG07506PPI
JCDBG15243JCDBG04352PPI
JCDBG15243JCDBG08109PPI
JCDBG15243JCDBG18419PPI
JCDBG15243JCDBG08310PPI
JCDBG13802JCDBG23997PPI
JCDBG13802JCDBG09234PPI
JCDBG13802JCDBG23469PPI
JCDBG13802JCDBG06148PPI
JCDBG13802JCDBG19936PPI
JCDBG13802JCDBG12398PPI
JCDBG10704JCDBG23088PPI
JCDBG23997JCDBG09234PPI
JCDBG23997JCDBG16262PPI
JCDBG23997JCDBG06148PPI
JCDBG23997JCDBG07506PPI
JCDBG23997JCDBG15223PPI
JCDBG23997JCDBG08109PPI
JCDBG23997JCDBG06075PPI
JCDBG09234JCDBG15223PPI
JCDBG09234JCDBG08109PPI
JCDBG23469JCDBG06148PPI
JCDBG23469JCDBG00558PPI
JCDBG23469JCDBG07506PPI
JCDBG23469JCDBG15223PPI
JCDBG23469JCDBG19936PPI
JCDBG23469JCDBG06075PPI
JCDBG23469JCDBG18419PPI
JCDBG08044JCDBG23088PPI
JCDBG08044JCDBG15143PPI
JCDBG08044JCDBG16262PPI
JCDBG08044JCDBG07506PPI
JCDBG08044JCDBG04352PPI
JCDBG08044JCDBG18419PPI
JCDBG08044JCDBG19616PPI
JCDBG08044JCDBG20886PPI
JCDBG23088JCDBG15143PPI
JCDBG23088JCDBG22121PPI
JCDBG23088JCDBG19616PPI
JCDBG03611JCDBG21164PPI
JCDBG03611JCDBG18679PPI
JCDBG03611JCDBG03609PPI
JCDBG21164JCDBG18679PPI
JCDBG21164JCDBG03609PPI
JCDBG17129JCDBG15223PPI
JCDBG17129JCDBG06075PPI
JCDBG17129JCDBG18419PPI
JCDBG17129JCDBG20886PPI
JCDBG15143JCDBG04352PPI
JCDBG15143JCDBG19616PPI
JCDBG06148JCDBG07506PPI
JCDBG06148JCDBG15223PPI
JCDBG06148JCDBG04352PPI
JCDBG06148JCDBG19936PPI
JCDBG06148JCDBG12398PPI
JCDBG06148JCDBG22121PPI
JCDBG06148JCDBG06075PPI
JCDBG18679JCDBG03609PPI
JCDBG00558JCDBG07506PPI
JCDBG00558JCDBG15223PPI
JCDBG00558JCDBG19936PPI
JCDBG00558JCDBG08109PPI
JCDBG00558JCDBG06075PPI
JCDBG07506JCDBG04352PPI
JCDBG07506JCDBG19936PPI
JCDBG07506JCDBG12398PPI
JCDBG07506JCDBG22121PPI
JCDBG07506JCDBG08310PPI
JCDBG15223JCDBG04352PPI
JCDBG15223JCDBG19936PPI
JCDBG15223JCDBG12398PPI
JCDBG15223JCDBG08310PPI
JCDBG04352JCDBG08109PPI
JCDBG04352JCDBG22121PPI
JCDBG04352JCDBG19616PPI
JCDBG19936JCDBG18629PPI
JCDBG19936JCDBG18419PPI
JCDBG14334JCDBG22121PPI
JCDBG12398JCDBG08109PPI
JCDBG12398JCDBG08310PPI
JCDBG08109JCDBG08310PPI
JCDBG22121JCDBG08310PPI
JCDBR00017
ID
JCDBR00017
Name
rpoC1
Type
protein_coding
Scaffold
NC_012224.1
Start
22413
End
25235
Strand
-
Exon
22413-24023,24804-25235
Sequence
TATGATTGATCGGTATAAACATCAACAACTCCGAATTGGATCAGTTTCGCCTCAACAAATAAGTGCTTGGGCCAATAAAA TCCTACCTAACGGAGAGATTGTTGGAGAGGTGACAAAACCCTATACTTTTCATTACAAAACCAATAAACCTGAAAAAGAT GGATTATTTTGTGAAAGAATTTTTGGGCCTATAAAAAGTGGAATTTGTGCTTGTGGAAATTATCGAGTAATCAGAAATGA AAAAGAAGACCCAAAATTTTGTGAACAATGCGGAGTCGAGTTTGTTGATTCTCGGATACGAAGATATCAAATGGGCTACA TCAAACTGGCATGCCCAGTAACTCATGTGTGGTATTTGAAACGTCTTCCTAGTTATATCGCAAATCTTTTAGATAAACCT CTTAAAGAATTAGAGGGCCTAGTATACTGCGATGTGTGATTTGATCGAAATTCTGATTTTACAGTTTTGGAATGAAAAAC TGTCATCCCATTTAATCGAATTGGGATGCCCCGGACCTGACATGTCGCTTGAAAGGAGTAACATGAAGCTCAGAATTATG GGTGTATTCAATACCCCCCAATAAAAGAGGAATTGGTCTATGGTCGATGCAGAAACAAATAAATAGGAATTCCTAGTTGT ATCTCGTGAAAACCGACTTCTTTCTTTTGCTTTTGTGGAATTAATCATTCCCTTTCTTTTTTTTTTAGAAAAAAAAGAAA CTATGTTTATACTCAAGTAAGCAAATATGTCATGGTTAAAGAAGTCTATACATCGCATATAGGCTTTAATGGCATCGTGG CATAACCGTCGAGGTGAGTTCGGGACCCAAAAGATCGAATAGAAAGAGACATAGACAAGTAAATCCCTTATGAATTCTAA GGTACTGGGAATTCATCATTCGAAGGGAAGTAGACTACTCAAGAATTTCACATTTCATTTAAGTCGTAATTGTGAGAATT GAATAAGTTGTGATAATTAAATAAAGAATTCAGAAATTCTAAAAAAAAATGGAAAAGAAGAATGAATCAATGAAAGCTTG CTTGGTATTCATCGGGAACTTGAGTAAGGAGTAGCTCTTTTGGGGGTTTTTCTCGATTTTGAAAGCAGGAACGAACCCCC TTTTTTTATTTGGTATAACTACTGGAGCCGGATGAGAGGAAACTTTCACGTCCGATTTTGAAGGGGGGAGACCCTATAGG ATCCTATCCCAATTTTTCTTTTGCTAGGCCCATAGCTAAAAAACCCACTTTTTTACGATTACGAGGTTCATTCGAATATG AAATCCAATCTTGGAAATACAGTATTCCACTTTTTTTTACTACCCAAGGCTTCGATACATTTCGAAATCGAGAAATTTCT ACAGGAGCTGGTGCTATCCGAGAACAATTAGCCGATCTGGATTTGCGAATTATTATAGATTATTCATCGGTAGAATGGAA AGAATTAGGGGAAGAAGGGCCTACAGGGAATGAATGGGAAGATCGAAAAGTTGGAAGAAGAAAGGATTTTTTGGTTAGAC GCGTGGAATTAGCTAAGCATTTTATTCGAACAAATATAGAACCAGAATGGATGGTTTTATGTCTATTACCGGTTCTTCCT CCCGAGTTGAGACCAATCATTCAGATAGATGGGGGTAAACTAATGAGTTCAGATATTAATGAACTCTATAGAAGAGTTAT CTATCGGAACAATACTCTTATTGATCTATTAACAACAAGTAGATCTACGCCAGGGGAATTAGTAATGTGTCAGGAGAAAT TGGTACAAGAAGCCGTGGATACACTTCTTGATAATGGAATCCGCGGACAACCTATGAGGGACGGTCATAATAAGGTTTAC AAGTCGTTTTCGGATGTAATTGAAGGCAAAGAAGGAAGATTTCGTGAGACTATGCTTGGCAAACGGGTTGATTATTCGGG GCGTTCTGTCATTGTCGTAGGCCCCTCACTTTCATTACATCGATGTGGATTGCCTCGCGAAATAGCAATAGAGCTTTTCC AGATATTTGTAATTCGTGGTCTAATTAGGCAACATCTTGCTTCGAACATAGGAGTTGCTAAGAGTAAAATTCGGGAAAAA GAACCAATTGTATGGGAAATACTTCAAGAAGTTATGCAGGGACATCCGGTATTACTGAATAGAGCGCCGACTCTGCATAG ATTAGGCATACAGGCGTTCCAACCCATTTTAGTGGAAGGCCGTGCTATTTGTTTACATCCATTGGTTTGTAAGGGATTCA ATGCAGACTTTGATGGGGATCAAATGGCTGTTCATGTACCTTTATCGTTGGAGGCTCAAACAGAGGCTCGTTTACTTATG TTTTCTCATATGAATCTCTTGTCTCCAGCTATTGGAGATCCCATCTCCGTACCAACTCAAGATATGCTTATTGGGCTCTA TGTATTAACAAGCGGGAATCGTCGAGGTATTTGTGCAAATAGGTATAATCCATGTAATCGCAGAAATTCTCAAAATGAAA GAATTGACGATAATAACAATAAATATACGAAAGAACCTTTTTTTTCTAATTCTTATGATGCAATTGGCGCTTTTCGGCGG AAAAGAATCAATTTAGATAGCCCTTTGTGGCTCCGGTGGCAACTAGATCAACGCGCTATTGTTTCAAGAGAAGCTCCCCT CGAAGTTCACTATGAATCTTTAGGTACCTATCATGAGATTTATGAACACTATCTAATAGTAAGAAATATAAAAAAAGAAA TTATTTGTATATACATTCGAACTACTGTTGGTCATATTTCTTTTTATCGAGAAATCGAAGAAGCTATACAAGGGTTTTGT CAAGCCTGCTCAGATGGTATCTA
Product
Source
RefSeq
Link:
JCDBP00011
ID
JCDBP00011
Parent
JCDBR00017
Name
YP_002720103.1
Scaffold
NC_012224.1
CDS
22413-24023,24804-25235
Strand:
-
Sequence
MIDRYKHQQLRIGSVSPQQISAWANKILPNGEIVGEVTKPYTFHYKTNKPEKDGLFCERIFGPIKSGICACGNYRVIRNE KEDPKFCEQCGVEFVDSRIRRYQMGYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFARPIAKKPTFLRL RGSFEYEIQSWKYSIPLFFTTQGFDTFRNREISTGAGAIREQLADLDLRIIIDYSSVEWKELGEEGPTGNEWEDRKVGRR KDFLVRRVELAKHFIRTNIEPEWMVLCLLPVLPPELRPIIQIDGGKLMSSDINELYRRVIYRNNTLIDLLTTSRSTPGEL VMCQEKLVQEAVDTLLDNGIRGQPMRDGHNKVYKSFSDVIEGKEGRFRETMLGKRVDYSGRSVIVVGPSLSLHRCGLPRE IAIELFQIFVIRGLIRQHLASNIGVAKSKIREKEPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGRAICLHP LVCKGFNADFDGDQMAVHVPLSLEAQTEARLLMFSHMNLLSPAIGDPISVPTQDMLIGLYVLTSGNRRGICANRYNPCNR RNSQNERIDDNNNKYTKEPFFSNSYDAIGAFRRKRINLDSPLWLRWQLDQRAIVSREAPLEVHYESLGTYHEIYEHYLIV RNIKKEIICIYIRTTVGHISFYREIEEAIQGFCQACSDGI
Product
RNA polymerase beta' subunit
Source
RefSeq
Link
YP_002720103.1
InterProScan
IPR000722 RNA polymerase, alpha subunit
IPR006592 RNA polymerase, N-terminal
IPR007066 RNA polymerase Rpb1, domain 3
IPR007080 RNA polymerase Rpb1, domain 1
Pfam
PF04997.8 RNA_pol_Rpb1_1 Domain
PF00623.16 RNA_pol_Rpb1_2 Domain
PF00623.16 RNA_pol_Rpb1_2 Domain
PF04983.14 RNA_pol_Rpb1_3 Domain