Detail information of JCDBG00018

JCDBG00018
ID
JCDBG00018
Name
rpoB
Type
protein_coding
Scaffold
NC_012224.1
Start
25275
End
28493
Strand
-
Link
Genbank id:7564840
Molecular function
GO:0003899 | DNA-directed RNA polymerase activity
GO:0032549 | ribonucleoside binding
GO:0003677 | DNA binding
Cellular component
Biological process
GO:0006351 | transcription, DNA-templated
KEGG
Entry: K03043
Name: rpoB
Definition: DNA-directed RNA polymerase subunit beta [EC:2.7.7.6]
ko00230:   Purine metabolism
ko00240:   Pyrimidine metabolism
ko03020:   RNA polymerase
Source
RefSeq
TF
Description
Sequence
AATGCTCGGGGATGGAAATGAGGGACTGTCTACAATACCTGGATTAAATCAGATACAATTTGAAGGATTTTGCGGGTTCA TTGATCAGGGCTTAACAGAAGAACTTTATAAGTTTCCAAAAATGGAAGATACAGATCAAGAAATTGAATTTCAATTATTT GTGGAAACATATCAATTAGTAGAGCCATTGATAAAAGAAAGAGATGCTGTATATGAATCACTTACATATTCTTCTGAATT ATATGTATCTGCGGGATTAATTTGGAAAACCAGTAGGGATATGCAAGAACAAACAATTTTTATTGGAAACATTCCTCTAA TGAATTCCCTGGGAACTTTTATAATAAATGGAATATACAGAATTGTGATCAATCAAATATTGCAAAGTCCCGGTATCTAT TACCGGTCAGAATTGGATCATAACGGAATCCCGGTCTATACCGGCACCATAATATCAGATTGGGGGGGAAGAGTAGAATT AGAGATTGATAGAAAAGCAAGGATATGGGCTCGTGTGAGTAGGAAACAGAAGATATCTATTCTAGTTTTATCATCAGCTA TGGGTTTGAATCTAAGAGAAATTTTAGAGAATGTGTGCTGCCCTGAAATTTTCTTATCTTTTCTGAATCTGAATGATAAG GGAAAAAAAAAAATGGGGTCAAAGGAAAATGCCATTTTGGAGTTTTATCAACAATTTACTTGTGTAGGCGGAGATCCAGT ATTTTCTGAATCCTTATGTAAGGAATTACAAAAGAAATTCTTTCAACAAAGATGTGAATTAGGAAGGATTGGTCGATTAA ATATGAACCGGAGACTGAATCTTGATATACCTCATAACAATACATTTTTGTTACCACGAGATATATTGGCAGCTGCGGAT CATTTGATTGGAATGAAATTTGGAATGGGTACACTTGACGATATGAATCATTTAAAAAATAAACGTATTCGTTCTGTAGC GGATCTCTTACAAGATCAATTCGGATTGGCTCTGATTCGTTTAGAAAACGTGGTTAGAGGGACTATATGGGGAGCAATTA GGCATAAATTGATACCGACCCCTCAAAATTTGGTAACTTCAACTCCATTAACAACTACTTATGAATCTTTTTTCGGATTA CACCCATTATCTCAAGTTTTGGATCGAACTAATCCATTGACACAAATAGTTCATGGGAGAAAATCGAGTTATTTGGGTCC TGGAGGATTAACGGGACGAACTGCTAGTTTTCGAATACGAGATATCCACCCTAGTCACTATGGGCGCATTTGCCCAATTG ACACGTCTGAAGGAATCAATGTTGGACTTATTGGGTCTTTAGCAATTCATGCCAAGATTGGTTATTGGGGGTCTTTAGAA AGCCCATTTTATGGAATCTCTGAGGGATCAAAAAAAGCACGGATGCTTTATTTATCACCAAATAGAGAGGAATACTATAG GGTAGCGGCAGGAAATTCTTTGGCGCTGAATCGAGGTGTTCAGGAAGAACAGGTTGCTCCAGCTCGATATCGTCAAGAAT TCCTGACTATTGCATGGGAACAGGTGCATCTTCGAAGTATTTTTCCCTTCCAATATTTTTCTATTGGAGCTTCCCTCATT CCTTTTATCGAGCATAATGATGCGAATCGGGCTTTAATGAGTTCTAATATGCAACGTCAGGCAGTTCCACTTTCTCGATC CGAAAAATGCATTGTTGGAACTGGATTGGAACGCCAAGTTTCTCTAGATTCAGGGGTTCCTGCTATAGCCGAACACGAGG GAAAGATAATTTATACTGATATTGACAAAATCATTTTATCGGGTAATGGAGATACTCTACGCATTCCATTAGTTATGTAT CAACGTTCCAACAAAAATACTTGTATGCATCAAAAAACCCAGGTTCAGCGGGGTAAATGCATTAAAAAGGGACAAGTTTT AGCGGATGGTGCCGCTACAGTTGGTGGCGAACTCGCCTTGGGCAAAAACGTATTAGTAGCTTATATGCCATGGGAGGGTT ACAATTTTGAGGATGCGGTGCTCATTAGCGAACGTCTGGTATATGAAGATATTTATACTTCTTTTCACATACGGAAATAT GAAATTCAGACTCATGTGACAAGCCAAGGACCTGAAAAGATCACTAATGAAATACCGCATCTAGAAGCCCATTTACTCCG AAATTTAGACAAAAATGGAATTGTGATCCTAGGATCTTGGGTGGAGACGGGCGATATTTTAGTAGGTAAATTAAGGCCTC AAATGGCGAAAGAATCATCGTATGCTCCAGAAGATAGATTATTAAGAGCTATACTTGGTATTCAGGTATCGACTTCAAAG GAAACTTGTCTAAAACTACCTATAGGTGGTAGGGGTCGAGTTATTGATGTGAGATGGATCCAGAAAAAGGGGGGTTCCAG TTATAATCCGGAAACGATTCGTGTCTATATTTTACAGAAACGTGAAATCAAAGTGGGTGATAAAGTAGCTGGAAGACATG GAAATAAAGGCATCATTTCCAAAATTTTGCCTAGACAGGATATGCCTTATTTGCAAGATGGAAGACCTGTTGATATGGTC TTCAACCCATTAGGAGTACCTTCACGAATGAATGTAGGACAGATATTTGAATGCTCACTCGGGTTAGCGGGGGGTCTGCT AGATAGACATTATCGAATAGCACCCTTTGATGAGAGATATGAACAAGAGGCTTCGAGAAAACTAGTGTTTTCGGAATTAT ATGAAGCCAGTAAGCAAACAGCAAATCCGTGGGTATTTGAACCCGAGTATCCGGGAAAAAGTAGAATATTTGATGGAAGA ACGGGGGATCCTTTTGAACAGCCTGTTATAATAGGAAAGCCTTATATCTTGAAATTAATTCATCAAGTTGATGATAAAAT ACATGGACGTTCCAGTGGACATTATGCACTTGTTACACAACAACCCCTTAGAGGAAGGGCCAAGCAAGGGGGACAACGGG TCGGAGAAATGGAGGTTTGGGCTCTAGAGGGATTTGGTGTTTCTCATATTTTACAAGAGATGCTTACTTATAAATCTGAT CATATTAGAGCTCGCCAAGAAGTACTTGGTACTACGATCATTGGGGGAACAATACCTAAACCTGAAGATGCTCCAGAATC TTTTCGATTGCTCGTTCGAGAACTACGATCTTTGGCTCTGGAACTGGATCATTTCCTTGTATCTGAGAAGAACTTCCAGA TTAATAGGAAGGAAGTTTA
Gene structure

JCDB Genes gff download

JCDBG00018 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00018's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00018JCDBG00041co-exp0.845236
JCDBG00018JCDBG00016co-exp0.816014
JCDBG00018JCDBG00100co-exp0.814589
JCDBG00018JCDBG00004co-exp0.798679
JCDBG00018JCDBG00011co-exp0.797195
JCDBG00018JCDBG00072co-exp0.789748
JCDBG00018JCDBG00042co-exp0.786843
JCDBG00018JCDBG00017co-exp0.785792
JCDBG00018JCDBG00047co-exp0.766866
JCDBG00018JCDBG00073co-exp0.751791
JCDBG00041JCDBG00016co-exp0.692918
JCDBG00041JCDBG00100co-exp0.801022
JCDBG00041JCDBG00004co-exp0.779883
JCDBG00041JCDBG00011co-exp0.909905
JCDBG00041JCDBG00072co-exp0.831358
JCDBG00041JCDBG00042co-exp0.747617
JCDBG00041JCDBG00047co-exp0.681668
JCDBG00041JCDBG00073co-exp0.746329
JCDBG00016JCDBG00100co-exp0.848717
JCDBG00016JCDBG00004co-exp0.672087
JCDBG00016JCDBG00011co-exp0.724041
JCDBG00016JCDBG00072co-exp0.783128
JCDBG00016JCDBG00042co-exp0.87673
JCDBG00016JCDBG00017co-exp0.87755
JCDBG00016JCDBG00047co-exp0.761544
JCDBG00016JCDBG00073co-exp0.842042
JCDBG00100JCDBG00004co-exp0.845048
JCDBG00100JCDBG00011co-exp0.815082
JCDBG00100JCDBG00072co-exp0.887318
JCDBG00100JCDBG00042co-exp0.91609
JCDBG00100JCDBG00017co-exp0.742444
JCDBG00100JCDBG00047co-exp0.821621
JCDBG00100JCDBG00073co-exp0.863882
JCDBG00004JCDBG00011co-exp0.745039
JCDBG00004JCDBG00072co-exp0.826225
JCDBG00004JCDBG00042co-exp0.814407
JCDBG00004JCDBG00017co-exp0.658617
JCDBG00004JCDBG00047co-exp0.839702
JCDBG00004JCDBG00073co-exp0.728283
JCDBG00011JCDBG00072co-exp0.837624
JCDBG00011JCDBG00042co-exp0.778524
JCDBG00011JCDBG00017co-exp0.6179
JCDBG00011JCDBG00047co-exp0.692492
JCDBG00011JCDBG00073co-exp0.809354
JCDBG00072JCDBG00042co-exp0.888954
JCDBG00072JCDBG00017co-exp0.653705
JCDBG00072JCDBG00047co-exp0.861011
JCDBG00072JCDBG00073co-exp0.777219
JCDBG00042JCDBG00017co-exp0.821724
JCDBG00042JCDBG00047co-exp0.899261
JCDBG00042JCDBG00073co-exp0.877775
JCDBG00017JCDBG00047co-exp0.726201
JCDBG00017JCDBG00073co-exp0.843437
JCDBG00047JCDBG00073co-exp0.698535
PPI network
node1node2type
JCDBG00018JCDBG24182PPI
JCDBG00018JCDBG07926PPI
JCDBG00018JCDBG15890PPI
JCDBG00018JCDBG21369PPI
JCDBG00018JCDBG05304PPI
JCDBG00018JCDBG11906PPI
JCDBG00018JCDBG23880PPI
JCDBG00018JCDBG15243PPI
JCDBG00018JCDBG19111PPI
JCDBG00018JCDBG13144PPI
JCDBG00018JCDBG23469PPI
JCDBG00018JCDBG08044PPI
JCDBG00018JCDBG24725PPI
JCDBG00018JCDBG18405PPI
JCDBG00018JCDBG03611PPI
JCDBG00018JCDBG21164PPI
JCDBG00018JCDBG17129PPI
JCDBG00018JCDBG16262PPI
JCDBG00018JCDBG24748PPI
JCDBG00018JCDBG18679PPI
JCDBG00018JCDBG00558PPI
JCDBG00018JCDBG04400PPI
JCDBG00018JCDBG05206PPI
JCDBG00018JCDBG17892PPI
JCDBG00018JCDBG12078PPI
JCDBG00018JCDBG03609PPI
JCDBG00018JCDBG17544PPI
JCDBG00018JCDBG09074PPI
JCDBG00018JCDBG00566PPI
JCDBG00018JCDBG12398PPI
JCDBG00018JCDBG08109PPI
JCDBG00018JCDBG08310PPI
JCDBG00018JCDBG17585PPI
JCDBG00018JCDBG24724PPI
JCDBG00018JCDBG20354PPI
JCDBG00018JCDBG11820PPI
JCDBG00018JCDBG20013PPI
JCDBG00018JCDBG20886PPI
JCDBG24182JCDBG21369PPI
JCDBG24182JCDBG23880PPI
JCDBG24182JCDBG23469PPI
JCDBG24182JCDBG08044PPI
JCDBG24182JCDBG18405PPI
JCDBG24182JCDBG17129PPI
JCDBG24182JCDBG24748PPI
JCDBG24182JCDBG00558PPI
JCDBG24182JCDBG12398PPI
JCDBG24182JCDBG08109PPI
JCDBG07926JCDBG23880PPI
JCDBG07926JCDBG24748PPI
JCDBG07926JCDBG04400PPI
JCDBG15890JCDBG03611PPI
JCDBG15890JCDBG21164PPI
JCDBG15890JCDBG24748PPI
JCDBG15890JCDBG18679PPI
JCDBG15890JCDBG03609PPI
JCDBG15890JCDBG08109PPI
JCDBG15890JCDBG20886PPI
JCDBG21369JCDBG23880PPI
JCDBG21369JCDBG18405PPI
JCDBG21369JCDBG04400PPI
JCDBG21369JCDBG09074PPI
JCDBG21369JCDBG08109PPI
JCDBG21369JCDBG17585PPI
JCDBG05304JCDBG15243PPI
JCDBG05304JCDBG24725PPI
JCDBG05304JCDBG17129PPI
JCDBG05304JCDBG24724PPI
JCDBG11906JCDBG00566PPI
JCDBG23880JCDBG15243PPI
JCDBG23880JCDBG23469PPI
JCDBG23880JCDBG08044PPI
JCDBG23880JCDBG17129PPI
JCDBG23880JCDBG24748PPI
JCDBG23880JCDBG00558PPI
JCDBG23880JCDBG17892PPI
JCDBG23880JCDBG08109PPI
JCDBG23880JCDBG08310PPI
JCDBG23880JCDBG17585PPI
JCDBG23880JCDBG20354PPI
JCDBG15243JCDBG23469PPI
JCDBG15243JCDBG08109PPI
JCDBG15243JCDBG08310PPI
JCDBG19111JCDBG24748PPI
JCDBG13144JCDBG17585PPI
JCDBG23469JCDBG18405PPI
JCDBG23469JCDBG00558PPI
JCDBG23469JCDBG04400PPI
JCDBG23469JCDBG17585PPI
JCDBG08044JCDBG16262PPI
JCDBG08044JCDBG17544PPI
JCDBG08044JCDBG20886PPI
JCDBG24725JCDBG24724PPI
JCDBG18405JCDBG17129PPI
JCDBG03611JCDBG21164PPI
JCDBG03611JCDBG18679PPI
JCDBG03611JCDBG03609PPI
JCDBG21164JCDBG18679PPI
JCDBG21164JCDBG03609PPI
JCDBG17129JCDBG24748PPI
JCDBG17129JCDBG04400PPI
JCDBG17129JCDBG20886PPI
JCDBG24748JCDBG09074PPI
JCDBG24748JCDBG08310PPI
JCDBG24748JCDBG17585PPI
JCDBG18679JCDBG03609PPI
JCDBG00558JCDBG04400PPI
JCDBG00558JCDBG08109PPI
JCDBG00558JCDBG20013PPI
JCDBG04400JCDBG09074PPI
JCDBG04400JCDBG08310PPI
JCDBG04400JCDBG17585PPI
JCDBG12398JCDBG08109PPI
JCDBG12398JCDBG08310PPI
JCDBG08109JCDBG08310PPI
JCDBG08310JCDBG17585PPI
JCDBG17585JCDBG20354PPI
JCDBR00018
ID
JCDBR00018
Name
rpoB
Type
protein_coding
Scaffold
NC_012224.1
Start
25275
End
28493
Strand
-
Exon
25275-28493
Sequence
AATGCTCGGGGATGGAAATGAGGGACTGTCTACAATACCTGGATTAAATCAGATACAATTTGAAGGATTTTGCGGGTTCA TTGATCAGGGCTTAACAGAAGAACTTTATAAGTTTCCAAAAATGGAAGATACAGATCAAGAAATTGAATTTCAATTATTT GTGGAAACATATCAATTAGTAGAGCCATTGATAAAAGAAAGAGATGCTGTATATGAATCACTTACATATTCTTCTGAATT ATATGTATCTGCGGGATTAATTTGGAAAACCAGTAGGGATATGCAAGAACAAACAATTTTTATTGGAAACATTCCTCTAA TGAATTCCCTGGGAACTTTTATAATAAATGGAATATACAGAATTGTGATCAATCAAATATTGCAAAGTCCCGGTATCTAT TACCGGTCAGAATTGGATCATAACGGAATCCCGGTCTATACCGGCACCATAATATCAGATTGGGGGGGAAGAGTAGAATT AGAGATTGATAGAAAAGCAAGGATATGGGCTCGTGTGAGTAGGAAACAGAAGATATCTATTCTAGTTTTATCATCAGCTA TGGGTTTGAATCTAAGAGAAATTTTAGAGAATGTGTGCTGCCCTGAAATTTTCTTATCTTTTCTGAATCTGAATGATAAG GGAAAAAAAAAAATGGGGTCAAAGGAAAATGCCATTTTGGAGTTTTATCAACAATTTACTTGTGTAGGCGGAGATCCAGT ATTTTCTGAATCCTTATGTAAGGAATTACAAAAGAAATTCTTTCAACAAAGATGTGAATTAGGAAGGATTGGTCGATTAA ATATGAACCGGAGACTGAATCTTGATATACCTCATAACAATACATTTTTGTTACCACGAGATATATTGGCAGCTGCGGAT CATTTGATTGGAATGAAATTTGGAATGGGTACACTTGACGATATGAATCATTTAAAAAATAAACGTATTCGTTCTGTAGC GGATCTCTTACAAGATCAATTCGGATTGGCTCTGATTCGTTTAGAAAACGTGGTTAGAGGGACTATATGGGGAGCAATTA GGCATAAATTGATACCGACCCCTCAAAATTTGGTAACTTCAACTCCATTAACAACTACTTATGAATCTTTTTTCGGATTA CACCCATTATCTCAAGTTTTGGATCGAACTAATCCATTGACACAAATAGTTCATGGGAGAAAATCGAGTTATTTGGGTCC TGGAGGATTAACGGGACGAACTGCTAGTTTTCGAATACGAGATATCCACCCTAGTCACTATGGGCGCATTTGCCCAATTG ACACGTCTGAAGGAATCAATGTTGGACTTATTGGGTCTTTAGCAATTCATGCCAAGATTGGTTATTGGGGGTCTTTAGAA AGCCCATTTTATGGAATCTCTGAGGGATCAAAAAAAGCACGGATGCTTTATTTATCACCAAATAGAGAGGAATACTATAG GGTAGCGGCAGGAAATTCTTTGGCGCTGAATCGAGGTGTTCAGGAAGAACAGGTTGCTCCAGCTCGATATCGTCAAGAAT TCCTGACTATTGCATGGGAACAGGTGCATCTTCGAAGTATTTTTCCCTTCCAATATTTTTCTATTGGAGCTTCCCTCATT CCTTTTATCGAGCATAATGATGCGAATCGGGCTTTAATGAGTTCTAATATGCAACGTCAGGCAGTTCCACTTTCTCGATC CGAAAAATGCATTGTTGGAACTGGATTGGAACGCCAAGTTTCTCTAGATTCAGGGGTTCCTGCTATAGCCGAACACGAGG GAAAGATAATTTATACTGATATTGACAAAATCATTTTATCGGGTAATGGAGATACTCTACGCATTCCATTAGTTATGTAT CAACGTTCCAACAAAAATACTTGTATGCATCAAAAAACCCAGGTTCAGCGGGGTAAATGCATTAAAAAGGGACAAGTTTT AGCGGATGGTGCCGCTACAGTTGGTGGCGAACTCGCCTTGGGCAAAAACGTATTAGTAGCTTATATGCCATGGGAGGGTT ACAATTTTGAGGATGCGGTGCTCATTAGCGAACGTCTGGTATATGAAGATATTTATACTTCTTTTCACATACGGAAATAT GAAATTCAGACTCATGTGACAAGCCAAGGACCTGAAAAGATCACTAATGAAATACCGCATCTAGAAGCCCATTTACTCCG AAATTTAGACAAAAATGGAATTGTGATCCTAGGATCTTGGGTGGAGACGGGCGATATTTTAGTAGGTAAATTAAGGCCTC AAATGGCGAAAGAATCATCGTATGCTCCAGAAGATAGATTATTAAGAGCTATACTTGGTATTCAGGTATCGACTTCAAAG GAAACTTGTCTAAAACTACCTATAGGTGGTAGGGGTCGAGTTATTGATGTGAGATGGATCCAGAAAAAGGGGGGTTCCAG TTATAATCCGGAAACGATTCGTGTCTATATTTTACAGAAACGTGAAATCAAAGTGGGTGATAAAGTAGCTGGAAGACATG GAAATAAAGGCATCATTTCCAAAATTTTGCCTAGACAGGATATGCCTTATTTGCAAGATGGAAGACCTGTTGATATGGTC TTCAACCCATTAGGAGTACCTTCACGAATGAATGTAGGACAGATATTTGAATGCTCACTCGGGTTAGCGGGGGGTCTGCT AGATAGACATTATCGAATAGCACCCTTTGATGAGAGATATGAACAAGAGGCTTCGAGAAAACTAGTGTTTTCGGAATTAT ATGAAGCCAGTAAGCAAACAGCAAATCCGTGGGTATTTGAACCCGAGTATCCGGGAAAAAGTAGAATATTTGATGGAAGA ACGGGGGATCCTTTTGAACAGCCTGTTATAATAGGAAAGCCTTATATCTTGAAATTAATTCATCAAGTTGATGATAAAAT ACATGGACGTTCCAGTGGACATTATGCACTTGTTACACAACAACCCCTTAGAGGAAGGGCCAAGCAAGGGGGACAACGGG TCGGAGAAATGGAGGTTTGGGCTCTAGAGGGATTTGGTGTTTCTCATATTTTACAAGAGATGCTTACTTATAAATCTGAT CATATTAGAGCTCGCCAAGAAGTACTTGGTACTACGATCATTGGGGGAACAATACCTAAACCTGAAGATGCTCCAGAATC TTTTCGATTGCTCGTTCGAGAACTACGATCTTTGGCTCTGGAACTGGATCATTTCCTTGTATCTGAGAAGAACTTCCAGA TTAATAGGAAGGAAGTTTA
Product
Source
RefSeq
Link:
JCDBP00012
ID
JCDBP00012
Parent
JCDBR00018
Name
YP_002720104.1
Scaffold
NC_012224.1
CDS
25275-28493
Strand:
-
Sequence
MLGDGNEGLSTIPGLNQIQFEGFCGFIDQGLTEELYKFPKMEDTDQEIEFQLFVETYQLVEPLIKERDAVYESLTYSSEL YVSAGLIWKTSRDMQEQTIFIGNIPLMNSLGTFIINGIYRIVINQILQSPGIYYRSELDHNGIPVYTGTIISDWGGRVEL EIDRKARIWARVSRKQKISILVLSSAMGLNLREILENVCCPEIFLSFLNLNDKGKKKMGSKENAILEFYQQFTCVGGDPV FSESLCKELQKKFFQQRCELGRIGRLNMNRRLNLDIPHNNTFLLPRDILAAADHLIGMKFGMGTLDDMNHLKNKRIRSVA DLLQDQFGLALIRLENVVRGTIWGAIRHKLIPTPQNLVTSTPLTTTYESFFGLHPLSQVLDRTNPLTQIVHGRKSSYLGP GGLTGRTASFRIRDIHPSHYGRICPIDTSEGINVGLIGSLAIHAKIGYWGSLESPFYGISEGSKKARMLYLSPNREEYYR VAAGNSLALNRGVQEEQVAPARYRQEFLTIAWEQVHLRSIFPFQYFSIGASLIPFIEHNDANRALMSSNMQRQAVPLSRS EKCIVGTGLERQVSLDSGVPAIAEHEGKIIYTDIDKIILSGNGDTLRIPLVMYQRSNKNTCMHQKTQVQRGKCIKKGQVL ADGAATVGGELALGKNVLVAYMPWEGYNFEDAVLISERLVYEDIYTSFHIRKYEIQTHVTSQGPEKITNEIPHLEAHLLR NLDKNGIVILGSWVETGDILVGKLRPQMAKESSYAPEDRLLRAILGIQVSTSKETCLKLPIGGRGRVIDVRWIQKKGGSS YNPETIRVYILQKREIKVGDKVAGRHGNKGIISKILPRQDMPYLQDGRPVDMVFNPLGVPSRMNVGQIFECSLGLAGGLL DRHYRIAPFDERYEQEASRKLVFSELYEASKQTANPWVFEPEYPGKSRIFDGRTGDPFEQPVIIGKPYILKLIHQVDDKI HGRSSGHYALVTQQPLRGRAKQGGQRVGEMEVWALEGFGVSHILQEMLTYKSDHIRARQEVLGTTIIGGTIPKPEDAPES FRLLVRELRSLALELDHFLVSEKNFQINRKEV
Product
RNA polymerase beta subunit
Source
RefSeq
Link
YP_002720104.1
InterProScan
IPR007120 DNA-directed RNA polymerase, subunit 2, domain 6
IPR007121 RNA polymerase, beta subunit, conserved site
IPR007641 RNA polymerase Rpb2, domain 7
IPR007642 RNA polymerase Rpb2, domain 2
IPR007644 RNA polymerase, beta subunit, protrusion
IPR007645 RNA polymerase Rpb2, domain 3
IPR010243 DNA-directed RNA polymerase beta subunit, bacterial-type
IPR014724 RNA polymerase Rpb2, OB-fold
IPR015712 DNA-directed RNA polymerase, subunit 2
Pfam
PF04563.11 RNA_pol_Rpb2_1 Family
PF04561.10 RNA_pol_Rpb2_2 Domain
PF04565.12 RNA_pol_Rpb2_3 Domain
PF00562.24 RNA_pol_Rpb2_6 Domain
PF04560.16 RNA_pol_Rpb2_7 Domain