Detail information of JCDBG00021

JCDBG00021
ID
JCDBG00021
Name
psbM
Type
protein_coding
Scaffold
NC_012224.1
Start
32146
End
32250
Strand
-
Link
Genbank id:7564843
Molecular function
Cellular component
GO:0009523 | photosystem II
GO:0016021 | integral component of membrane
Biological process
GO:0019684 | photosynthesis, light reaction
GO:0015979 | photosynthesis
KEGG
Entry: K02714
Name: psbM
Definition: photosystem II PsbM protein
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TATGGAAGTAAATATTCTTGCATTTATTGCTACTGCACTGTTCATTCTAGTTCCTACCGCTTTTTTACTTATAATATACG TAAAAACAGTTAGTCAAGGCGATTA
Gene structure

JCDB Genes gff download

JCDBG00021 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00021's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00021JCDBG00012co-exp0.880718
JCDBG00021JCDBG00112co-exp0.864281
JCDBG00021JCDBG00011co-exp0.86141
JCDBG00021JCDBG00037co-exp0.85541
JCDBG00021JCDBG00046co-exp0.846811
JCDBG00021JCDBG00075co-exp0.843724
JCDBG00021JCDBG00065co-exp0.836
JCDBG00021JCDBG02901co-exp0.83291
JCDBG00021JCDBG00063co-exp0.828418
JCDBG00021JCDBG11239co-exp0.826203
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG00011co-exp0.834419
JCDBG00012JCDBG00037co-exp0.963833
JCDBG00012JCDBG00046co-exp0.949104
JCDBG00012JCDBG00075co-exp0.912519
JCDBG00012JCDBG00065co-exp0.946607
JCDBG00012JCDBG02901co-exp0.857076
JCDBG00012JCDBG00063co-exp0.938615
JCDBG00012JCDBG11239co-exp0.912939
JCDBG00112JCDBG00011co-exp0.812285
JCDBG00112JCDBG00037co-exp0.958141
JCDBG00112JCDBG00046co-exp0.924872
JCDBG00112JCDBG00075co-exp0.92744
JCDBG00112JCDBG00065co-exp0.944148
JCDBG00112JCDBG02901co-exp0.83942
JCDBG00112JCDBG00063co-exp0.929563
JCDBG00112JCDBG11239co-exp0.919971
JCDBG00011JCDBG00037co-exp0.772141
JCDBG00011JCDBG00046co-exp0.777465
JCDBG00011JCDBG00075co-exp0.725212
JCDBG00011JCDBG00065co-exp0.738973
JCDBG00011JCDBG02901co-exp0.716372
JCDBG00011JCDBG00063co-exp0.732933
JCDBG00011JCDBG11239co-exp0.700402
JCDBG00037JCDBG00046co-exp0.956923
JCDBG00037JCDBG00075co-exp0.939222
JCDBG00037JCDBG00065co-exp0.962165
JCDBG00037JCDBG02901co-exp0.844283
JCDBG00037JCDBG00063co-exp0.966339
JCDBG00037JCDBG11239co-exp0.943379
JCDBG00046JCDBG00075co-exp0.886163
JCDBG00046JCDBG00065co-exp0.954196
JCDBG00046JCDBG02901co-exp0.818444
JCDBG00046JCDBG00063co-exp0.932346
JCDBG00046JCDBG11239co-exp0.899265
JCDBG00075JCDBG00065co-exp0.920844
JCDBG00075JCDBG02901co-exp0.833247
JCDBG00075JCDBG00063co-exp0.953019
JCDBG00075JCDBG11239co-exp0.952265
JCDBG00065JCDBG02901co-exp0.804997
JCDBG00065JCDBG00063co-exp0.942622
JCDBG00065JCDBG11239co-exp0.91345
JCDBG02901JCDBG00063co-exp0.835325
JCDBG02901JCDBG11239co-exp0.846675
JCDBG00063JCDBG11239co-exp0.950032
PPI network
node1node2type
JCDBR00021
ID
JCDBR00021
Name
psbM
Type
protein_coding
Scaffold
NC_012224.1
Start
32146
End
32250
Strand
-
Exon
32146-32250
Sequence
TATGGAAGTAAATATTCTTGCATTTATTGCTACTGCACTGTTCATTCTAGTTCCTACCGCTTTTTTACTTATAATATACG TAAAAACAGTTAGTCAAGGCGATTA
Product
Source
RefSeq
Link:
JCDBP00014
ID
JCDBP00014
Parent
JCDBR00021
Name
YP_002720106.1
Scaffold
NC_012224.1
CDS
32146-32250
Strand:
-
Sequence
MEVNILAFIATALFILVPTAFLLIIYVKTVSQGD
Product
photosystem II protein M
Source
RefSeq
Link
YP_002720106.1
InterProScan
IPR007826 Photosystem II PsbM
Pfam
PF05151.8 PsbM Family