Detail information of JCDBG00026

JCDBG00026
ID
JCDBG00026
Name
psbD
Type
protein_coding
Scaffold
NC_012224.1
Start
37203
End
38264
Strand
+
Link
Genbank id:7564848 | Jatropha Genome Database ID:Jcr4S20322.10
Molecular function
GO:0045156 | electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
Cellular component
GO:0016020 | membrane
GO:0009523 | photosystem II
Biological process
GO:0009772 | photosynthetic electron transport in photosystem II
GO:0019684 | photosynthesis, light reaction
GO:0015979 | photosynthesis
KEGG
Entry: K02706
Name: psbD
Definition: photosystem II P680 reaction center D2 protein [EC:1.10.3.9]
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGACTATAGCCCTTGGTAAATTTACCAAAGACGAAAATGATTTATTTGATATTATGGATGACTGGTTACGGAGGGACCGT TTCGTTTTTGTAGGTTGGTCCGGTCTATTGCTCTTTCCTTGCGCCTATTTCGCCTTAGGGGGTTGGTTCACAGGTACAAC CTTTGTAACCTCATGGTATACCCATGGATTGGCTAGTTCCTATTTGGAAGGCTGCAACTTCTTAACCGCTGCAGTTTCTA CTCCTGCTAATAGTTTAGCGCATTCTTTGTTATTACTATGGGGTCCCGAAGCACAAGGGGATTTTACTCGTTGGTGTCAA TTAGGCGGTTTGTGGACTTTTGTTGCTCTCCACGGTGCTTTCGGACTAATAGGTTTTATGTTACGTCAATTTGAACTTGC TCGATCCGTGCAATTGCGACCTTATAATGCAATCGCATTCTCTGGTCCAATTGCTGTTTTTGTTTCTGTATTCCTGATTT ATCCACTAGGTCAGTCTGGTTGGTTTTTTGCGCCTAGTTTTGGTGTAGCAGCTATATTTCGATTCATCCTCTTTTTCCAA GGGTTTCATAACTGGACGCTGAACCCATTTCATATGATGGGGGTTGCCGGCGTATTAGGTGCTGCTCTGCTATGCGCTAT TCATGGTGCTACTGTAGAAAATACTTTATTTGAAGATGGTGATGGTGCAAATACATTCCGTGCTTTTAACCCAACTCAAG CCGAAGAAACTTATTCAATGGTTACCGCTAACCGCTTTTGGTCCCAAATCTTTGGGGTTGCTTTTTCCAATAAACGTTGG TTACATTTCTTTATGTTATTTGTACCAGTAACCGGTTTATGGATGAGTGCTCTTGGAGTAGTCGGTCTGGCTCTGAATCT ACGTGCCTATGACTTCGTTTCTCAGGAGATCCGTGCAGCGGAAGATCCTGAATTTGAGACTTTCTACACTAAAAATATTC TCTTAAACGAAGGTATTCGTGCTTGGATGGCGGCTCAAGATCAGCCTCATGAAAACCTTATATTCCCTGAGGAGGTTCTA CCACGTGGAAACGCTCTTTAAT
Gene structure

JCDB Genes gff download

JCDBG00026 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00026's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00026JCDBG00027co-exp0.967986
JCDBG00026JCDBG00033co-exp0.950075
JCDBG00026JCDBG00071co-exp0.934561
JCDBG00026JCDBG00002co-exp0.926188
JCDBG00026JCDBG00047co-exp0.916383
JCDBG00026JCDBG00067co-exp0.902249
JCDBG00026JCDBG00034co-exp0.863772
JCDBG00026JCDBG00048co-exp0.835686
JCDBG00026JCDBG08737co-exp0.829573
JCDBG00026JCDBG00072co-exp0.818663
JCDBG00027JCDBG00033co-exp0.935167
JCDBG00027JCDBG00071co-exp0.925427
JCDBG00027JCDBG00002co-exp0.921385
JCDBG00027JCDBG00047co-exp0.913089
JCDBG00027JCDBG00067co-exp0.928913
JCDBG00027JCDBG00034co-exp0.884364
JCDBG00027JCDBG00048co-exp0.818448
JCDBG00027JCDBG08737co-exp0.847582
JCDBG00027JCDBG00072co-exp0.834429
JCDBG00033JCDBG00071co-exp0.899852
JCDBG00033JCDBG00002co-exp0.899406
JCDBG00033JCDBG00047co-exp0.885043
JCDBG00033JCDBG00067co-exp0.87946
JCDBG00033JCDBG00034co-exp0.902027
JCDBG00033JCDBG00048co-exp0.814849
JCDBG00033JCDBG08737co-exp0.840223
JCDBG00033JCDBG00072co-exp0.825452
JCDBG00071JCDBG00002co-exp0.893332
JCDBG00071JCDBG00047co-exp0.937953
JCDBG00071JCDBG00067co-exp0.921919
JCDBG00071JCDBG00034co-exp0.815403
JCDBG00071JCDBG00048co-exp0.8096
JCDBG00071JCDBG08737co-exp0.779937
JCDBG00071JCDBG00072co-exp0.850068
JCDBG00002JCDBG00047co-exp0.867959
JCDBG00002JCDBG00067co-exp0.859833
JCDBG00002JCDBG00034co-exp0.816051
JCDBG00002JCDBG00048co-exp0.845832
JCDBG00002JCDBG08737co-exp0.798689
JCDBG00002JCDBG00072co-exp0.717616
JCDBG00047JCDBG00067co-exp0.923353
JCDBG00047JCDBG00034co-exp0.836956
JCDBG00047JCDBG00048co-exp0.772043
JCDBG00047JCDBG08737co-exp0.74659
JCDBG00047JCDBG00072co-exp0.861011
JCDBG00067JCDBG00034co-exp0.84116
JCDBG00067JCDBG00048co-exp0.722515
JCDBG00067JCDBG08737co-exp0.810925
JCDBG00067JCDBG00072co-exp0.876583
JCDBG00034JCDBG00048co-exp0.674514
JCDBG00034JCDBG08737co-exp0.773677
JCDBG00034JCDBG00072co-exp0.849769
JCDBG00048JCDBG08737co-exp0.694111
JCDBG00048JCDBG00072co-exp0.601336
JCDBG08737JCDBG00072co-exp0.780277
PPI network
node1node2type
JCDBG00026JCDBG03287PPI
JCDBR00026
ID
JCDBR00026
Name
psbD
Type
protein_coding
Scaffold
NC_012224.1
Start
37203
End
38264
Strand
+
Exon
37203-38264
Sequence
TGACTATAGCCCTTGGTAAATTTACCAAAGACGAAAATGATTTATTTGATATTATGGATGACTGGTTACGGAGGGACCGT TTCGTTTTTGTAGGTTGGTCCGGTCTATTGCTCTTTCCTTGCGCCTATTTCGCCTTAGGGGGTTGGTTCACAGGTACAAC CTTTGTAACCTCATGGTATACCCATGGATTGGCTAGTTCCTATTTGGAAGGCTGCAACTTCTTAACCGCTGCAGTTTCTA CTCCTGCTAATAGTTTAGCGCATTCTTTGTTATTACTATGGGGTCCCGAAGCACAAGGGGATTTTACTCGTTGGTGTCAA TTAGGCGGTTTGTGGACTTTTGTTGCTCTCCACGGTGCTTTCGGACTAATAGGTTTTATGTTACGTCAATTTGAACTTGC TCGATCCGTGCAATTGCGACCTTATAATGCAATCGCATTCTCTGGTCCAATTGCTGTTTTTGTTTCTGTATTCCTGATTT ATCCACTAGGTCAGTCTGGTTGGTTTTTTGCGCCTAGTTTTGGTGTAGCAGCTATATTTCGATTCATCCTCTTTTTCCAA GGGTTTCATAACTGGACGCTGAACCCATTTCATATGATGGGGGTTGCCGGCGTATTAGGTGCTGCTCTGCTATGCGCTAT TCATGGTGCTACTGTAGAAAATACTTTATTTGAAGATGGTGATGGTGCAAATACATTCCGTGCTTTTAACCCAACTCAAG CCGAAGAAACTTATTCAATGGTTACCGCTAACCGCTTTTGGTCCCAAATCTTTGGGGTTGCTTTTTCCAATAAACGTTGG TTACATTTCTTTATGTTATTTGTACCAGTAACCGGTTTATGGATGAGTGCTCTTGGAGTAGTCGGTCTGGCTCTGAATCT ACGTGCCTATGACTTCGTTTCTCAGGAGATCCGTGCAGCGGAAGATCCTGAATTTGAGACTTTCTACACTAAAAATATTC TCTTAAACGAAGGTATTCGTGCTTGGATGGCGGCTCAAGATCAGCCTCATGAAAACCTTATATTCCCTGAGGAGGTTCTA CCACGTGGAAACGCTCTTTAAT
Product
Source
RefSeq
Link:
JCDBP00015
ID
JCDBP00015
Parent
JCDBR00026
Name
YP_002720107.1
Scaffold
NC_012224.1
CDS
37203-38264
Strand:
+
Sequence
MTIALGKFTKDENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVS TPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGAFGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLI YPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNI LLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Product
photosystem II protein D2
Source
RefSeq
Link
YP_002720107.1
InterProScan
IPR000484 Photosynthetic reaction centre, L/M
IPR005868 Photosystem II D2 protein
Pfam
PF00124.15 Photo_RC Family