Detail information of JCDBG00029

JCDBG00029
ID
JCDBG00029
Name
psbZ
Type
protein_coding
Scaffold
NC_012224.1
Start
40333
End
40521
Strand
+
Link
Genbank id:7564851
Molecular function
Cellular component
GO:0009539 | photosystem II reaction center
GO:0009523 | photosystem II
Biological process
GO:0042549 | photosystem II stabilization
GO:0015979 | photosynthesis
KEGG
Entry: K02724
Name: psbZ
Definition: photosystem II PsbZ protein
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGATTATTGCTTTCCAATTGGCTGTTTTTGCATTAATTGCTACTTCATCAATCTTACTGATTAGTGTACCCGTTGTTTTT TCTTCTCCTGATGGTTGGTCAAGTAACAAAAATGTTGTATTTTCTGGTACATCATTATGGATTGGATTAGTTTTTCTGGT AGGTATCCTTAATTCTCTCATCTCTTGAA
Gene structure

JCDB Genes gff download

JCDBG00029 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00029's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00029JCDBG00013co-exp0.954387
JCDBG00029JCDBG00043co-exp0.950823
JCDBG00029JCDBG00014co-exp0.879308
JCDBG00029JCDBG00064co-exp0.87883
JCDBG00029JCDBG00020co-exp0.868454
JCDBG00029JCDBG00015co-exp0.810684
JCDBG00029JCDBG06171co-exp0.801198
JCDBG00029JCDBG10658co-exp0.792627
JCDBG00029JCDBG10097co-exp0.790134
JCDBG00029JCDBG17813co-exp-0.787629
JCDBG00013JCDBG00043co-exp0.958265
JCDBG00013JCDBG00014co-exp0.863631
JCDBG00013JCDBG00064co-exp0.907456
JCDBG00013JCDBG00020co-exp0.882966
JCDBG00013JCDBG00015co-exp0.801903
JCDBG00013JCDBG06171co-exp0.758605
JCDBG00013JCDBG10658co-exp0.773862
JCDBG00013JCDBG10097co-exp0.796858
JCDBG00013JCDBG17813co-exp-0.816654
JCDBG00043JCDBG00014co-exp0.885746
JCDBG00043JCDBG00064co-exp0.912455
JCDBG00043JCDBG00020co-exp0.888094
JCDBG00043JCDBG00015co-exp0.838211
JCDBG00043JCDBG06171co-exp0.786981
JCDBG00043JCDBG10658co-exp0.787099
JCDBG00043JCDBG10097co-exp0.801265
JCDBG00043JCDBG17813co-exp-0.795074
JCDBG00014JCDBG00064co-exp0.756636
JCDBG00014JCDBG00020co-exp0.710887
JCDBG00014JCDBG00015co-exp0.962428
JCDBG00014JCDBG06171co-exp0.656432
JCDBG00014JCDBG10658co-exp0.648691
JCDBG00014JCDBG10097co-exp0.679682
JCDBG00014JCDBG17813co-exp-0.644969
JCDBG00064JCDBG00020co-exp0.899486
JCDBG00064JCDBG00015co-exp0.698302
JCDBG00064JCDBG06171co-exp0.710009
JCDBG00064JCDBG10658co-exp0.779946
JCDBG00064JCDBG10097co-exp0.752264
JCDBG00064JCDBG17813co-exp-0.814532
JCDBG00020JCDBG00015co-exp0.679902
JCDBG00020JCDBG06171co-exp0.709782
JCDBG00020JCDBG10658co-exp0.798832
JCDBG00020JCDBG10097co-exp0.797362
JCDBG00020JCDBG17813co-exp-0.793444
JCDBG00015JCDBG06171co-exp0.609083
JCDBG00015JCDBG10658co-exp0.610051
JCDBG00015JCDBG10097co-exp0.645351
JCDBG06171JCDBG10658co-exp0.793665
JCDBG06171JCDBG10097co-exp0.81798
JCDBG06171JCDBG17813co-exp-0.799635
JCDBG10658JCDBG10097co-exp0.764371
JCDBG10658JCDBG17813co-exp-0.826204
JCDBG10097JCDBG17813co-exp-0.822646
PPI network
node1node2type
JCDBR00029
ID
JCDBR00029
Name
psbZ
Type
protein_coding
Scaffold
NC_012224.1
Start
40333
End
40521
Strand
+
Exon
40333-40521
Sequence
TGATTATTGCTTTCCAATTGGCTGTTTTTGCATTAATTGCTACTTCATCAATCTTACTGATTAGTGTACCCGTTGTTTTT TCTTCTCCTGATGGTTGGTCAAGTAACAAAAATGTTGTATTTTCTGGTACATCATTATGGATTGGATTAGTTTTTCTGGT AGGTATCCTTAATTCTCTCATCTCTTGAA
Product
Source
RefSeq
Link:
JCDBP00017
ID
JCDBP00017
Parent
JCDBR00029
Name
YP_002720109.1
Scaffold
NC_012224.1
CDS
40333-40521
Strand:
+
Sequence
MIIAFQLAVFALIATSSILLISVPVVFSSPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS
Product
psbZ
Source
RefSeq
Link
YP_002720109.1
InterProScan
IPR002644 Photosystem II PsbZ, reaction centre
Pfam
PF01737.13 Ycf9 Family