Detail information of JCDBG00032

JCDBG00032
ID
JCDBG00032
Name
rps14
Type
protein_coding
Scaffold
NC_012224.1
Start
41894
End
42196
Strand
-
Link
Genbank id:7564854
Molecular function
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0005622 | intracellular
Biological process
GO:0006412 | translation
KEGG
Entry: K02954
Name: RP-S14, MRPS14, rpsN
Definition: small subunit ribosomal protein S14
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
TATGGCAAGGAAAAGTTTGATTCAGCGGGAGAAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCGATCCT CAAAAAAAGAAATAAGCGAAGTTCTATCGTTGAGTGATAAATGGGAAATTCATGGAAAGTTACAATCCCTACCGCGAAAT AGTGCACCGACACGTCTTCATCGACGTTGTTTTTCGACTGGAAGACCGAGAGCTAACTATCGAGACTTTGGGCTATCTGG ACACATACTTCGTGAAATGGTTCATGCATGTTTGTTACCGGGGGTAACAAGATCAAGTTGGTA
Gene structure

JCDB Genes gff download

JCDBG00032 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00032's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00032JCDBG00046co-exp0.945749
JCDBG00032JCDBG00012co-exp0.935341
JCDBG00032JCDBG07355co-exp0.933694
JCDBG00032JCDBG00037co-exp0.917854
JCDBG00032JCDBG00070co-exp0.913395
JCDBG00032JCDBG00065co-exp0.899738
JCDBG00032JCDBG00063co-exp0.894993
JCDBG00032JCDBG00112co-exp0.894441
JCDBG00032JCDBG18553co-exp0.882414
JCDBG00032JCDBG04287co-exp0.877753
JCDBG00046JCDBG00012co-exp0.949104
JCDBG00046JCDBG07355co-exp0.936736
JCDBG00046JCDBG00037co-exp0.956923
JCDBG00046JCDBG00070co-exp0.918786
JCDBG00046JCDBG00065co-exp0.954196
JCDBG00046JCDBG00063co-exp0.932346
JCDBG00046JCDBG00112co-exp0.924872
JCDBG00046JCDBG18553co-exp0.885336
JCDBG00046JCDBG04287co-exp0.852583
JCDBG00012JCDBG07355co-exp0.91033
JCDBG00012JCDBG00037co-exp0.963833
JCDBG00012JCDBG00070co-exp0.911621
JCDBG00012JCDBG00065co-exp0.946607
JCDBG00012JCDBG00063co-exp0.938615
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG18553co-exp0.879474
JCDBG00012JCDBG04287co-exp0.85859
JCDBG07355JCDBG00037co-exp0.930475
JCDBG07355JCDBG00070co-exp0.909479
JCDBG07355JCDBG00065co-exp0.934898
JCDBG07355JCDBG00063co-exp0.927425
JCDBG07355JCDBG00112co-exp0.887364
JCDBG07355JCDBG18553co-exp0.882328
JCDBG07355JCDBG04287co-exp0.911766
JCDBG00037JCDBG00070co-exp0.943138
JCDBG00037JCDBG00065co-exp0.962165
JCDBG00037JCDBG00063co-exp0.966339
JCDBG00037JCDBG00112co-exp0.958141
JCDBG00037JCDBG18553co-exp0.901587
JCDBG00037JCDBG04287co-exp0.864966
JCDBG00070JCDBG00065co-exp0.908277
JCDBG00070JCDBG00063co-exp0.952478
JCDBG00070JCDBG00112co-exp0.886046
JCDBG00070JCDBG18553co-exp0.897141
JCDBG00070JCDBG04287co-exp0.860588
JCDBG00065JCDBG00063co-exp0.942622
JCDBG00065JCDBG00112co-exp0.944148
JCDBG00065JCDBG18553co-exp0.86724
JCDBG00065JCDBG04287co-exp0.836956
JCDBG00063JCDBG00112co-exp0.929563
JCDBG00063JCDBG18553co-exp0.883273
JCDBG00063JCDBG04287co-exp0.881031
JCDBG00112JCDBG18553co-exp0.839802
JCDBG00112JCDBG04287co-exp0.825501
JCDBG18553JCDBG04287co-exp0.850459
PPI network
node1node2type
JCDBG00032JCDBG24182PPI
JCDBG00032JCDBG16654PPI
JCDBG00032JCDBG09324PPI
JCDBG00032JCDBG08285PPI
JCDBG00032JCDBG14958PPI
JCDBG00032JCDBG17434PPI
JCDBG00032JCDBG21369PPI
JCDBG00032JCDBG23530PPI
JCDBG00032JCDBG18937PPI
JCDBG00032JCDBG10704PPI
JCDBG00032JCDBG03794PPI
JCDBG00032JCDBG09234PPI
JCDBG00032JCDBG23469PPI
JCDBG00032JCDBG09164PPI
JCDBG00032JCDBG08468PPI
JCDBG00032JCDBG21747PPI
JCDBG00032JCDBG00558PPI
JCDBG00032JCDBG15810PPI
JCDBG00032JCDBG13807PPI
JCDBG00032JCDBG20895PPI
JCDBG00032JCDBG23734PPI
JCDBG00032JCDBG19428PPI
JCDBG00032JCDBG03587PPI
JCDBG24182JCDBG16654PPI
JCDBG24182JCDBG09324PPI
JCDBG24182JCDBG14958PPI
JCDBG24182JCDBG17434PPI
JCDBG24182JCDBG21369PPI
JCDBG24182JCDBG23530PPI
JCDBG24182JCDBG03794PPI
JCDBG24182JCDBG09234PPI
JCDBG24182JCDBG23469PPI
JCDBG24182JCDBG09164PPI
JCDBG24182JCDBG08468PPI
JCDBG24182JCDBG21747PPI
JCDBG24182JCDBG00558PPI
JCDBG24182JCDBG15810PPI
JCDBG24182JCDBG23734PPI
JCDBG24182JCDBG03587PPI
JCDBG16654JCDBG23530PPI
JCDBG16654JCDBG03794PPI
JCDBG16654JCDBG09234PPI
JCDBG16654JCDBG23469PPI
JCDBG16654JCDBG03587PPI
JCDBG09324JCDBG14958PPI
JCDBG09324JCDBG03794PPI
JCDBG14958JCDBG03794PPI
JCDBG17434JCDBG23530PPI
JCDBG17434JCDBG23469PPI
JCDBG21369JCDBG23530PPI
JCDBG21369JCDBG09234PPI
JCDBG23530JCDBG03794PPI
JCDBG23530JCDBG09234PPI
JCDBG23530JCDBG23469PPI
JCDBG23530JCDBG00558PPI
JCDBG23530JCDBG03587PPI
JCDBG18937JCDBG10704PPI
JCDBG10704JCDBG03794PPI
JCDBG03794JCDBG09234PPI
JCDBG03794JCDBG23469PPI
JCDBG03794JCDBG21747PPI
JCDBG03794JCDBG00558PPI
JCDBG03794JCDBG15810PPI
JCDBG03794JCDBG03587PPI
JCDBG23469JCDBG00558PPI
JCDBG23469JCDBG03587PPI
JCDBG08468JCDBG03587PPI
JCDBR00032
ID
JCDBR00032
Name
rps14
Type
protein_coding
Scaffold
NC_012224.1
Start
41894
End
42196
Strand
-
Exon
41894-42196
Sequence
TATGGCAAGGAAAAGTTTGATTCAGCGGGAGAAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCGATCCT CAAAAAAAGAAATAAGCGAAGTTCTATCGTTGAGTGATAAATGGGAAATTCATGGAAAGTTACAATCCCTACCGCGAAAT AGTGCACCGACACGTCTTCATCGACGTTGTTTTTCGACTGGAAGACCGAGAGCTAACTATCGAGACTTTGGGCTATCTGG ACACATACTTCGTGAAATGGTTCATGCATGTTTGTTACCGGGGGTAACAAGATCAAGTTGGTA
Product
Source
RefSeq
Link:
JCDBP00018
ID
JCDBP00018
Parent
JCDBR00032
Name
YP_002720110.1
Scaffold
NC_012224.1
CDS
41894-42196
Strand:
-
Sequence
MARKSLIQREKKRQKLEQKYHLIRRSSKKEISEVLSLSDKWEIHGKLQSLPRNSAPTRLHRRCFSTGRPRANYRDFGLSG HILREMVHACLLPGVTRSSW
Product
ribosomal protein S14
Source
RefSeq
Link
YP_002720110.1
InterProScan
IPR001209 Ribosomal protein S14
IPR018271 Ribosomal protein S14, conserved site
IPR023036 Ribosomal protein S14, bacterial/plastid
Pfam
PF00253.17 Ribosomal_S14 Family