Detail information of JCDBG00033

JCDBG00033
ID
JCDBG00033
Name
psaB
Type
protein_coding
Scaffold
NC_012224.1
Start
42314
End
44518
Strand
-
Link
Genbank id:7564855
Molecular function
Cellular component
GO:0016021 | integral component of membrane
GO:0009579 | thylakoid
GO:0009522 | photosystem I
Biological process
GO:0015979 | photosynthesis
KEGG
Entry: K02690
Name: psaB
Definition: photosystem I P700 chlorophyll a apoprotein A2
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TATGGCATTAAGATTTCCAAGGTTTAGCCAAGGCTTAGCTCAGGACCCCACTACTCGTCGTATTTGGTTTGGTATTGCTA CCGCACATGACTTCGAGAGTCATGATGATATTACGGAGGAACGGCTTTATCAGAATATTTTTGCTTCCCACTTCGGACAA TTAGCAATAATTTTTCTGTGGACTTCCGGAAATCTCTTTCATGTAGCTTGGCAAGGAAATTTTGAAGCATGGGTACAGGA CCCTTTACACGTAAGACCTATTGCTCATGCAATTTGGGATCCTCATTTTGGCCAACCGGCCGTGGAAGCTTTTACTCGAG GGGGCGCCCCTGGCCCAGTGAATATCGCTTATTCTGGTGTTTATCAATGGTGGTATACAATCGGTTTACGTACTAACGAA GATCTTTATATTGGAGCTCTTTTTCTATTATTTCTTTCTGCCCTAGCCTTATTAGGGGGTTGGTTACACCTACAACCGAA ATGGAAACCGAGCGTTTCGTGGTTCAAAAACGCCGAATCTCGTCTCAATCATCATTTGTCGGGACTATTCGGAGTAAGCT CTTTAGCTTGGACAGGACATTTAGTCCATGTCGCTATTCCTGGTTCCAGGGGCGAATACGTTCGATGGAATAATTTCTTA GATGTATTACCCCATCCCCAAGGATTAGGCCCCCTTTTTACAGGTCAGTGGAATCTTTATGCTCAAAATCCCGATTCAGG TAGTCATTTATTTGGTACCTCCCAAGGATCAGGAACTGCCATTCTAACCCTTCTCGGGGGGTTCCATCCACAAACACAAA GTTTATGGCTGACCGATATTGCACACCATCATTTAGCTATTGCATTTCTTTTTCTCGTTGCCGGTCATATGTATAGAACT AACTTCGGGATTGGGCACAGTATAAAAGATCTTTTAGAAGCACATATTCCTCCCGGGGGGCGATTGGGGAGTGGACATAA GGGTCTTTATGACACAATCAACAATTCGCTTCATTTTCAATTAGGCCTTGCTCTAGCTTCTTTAGGGGTTATTACTTCCT TAGTAGCTCAACACATGTACTCATTACCTGCTTATGCATTCATAGCGCAAGACTTTACTACTCAAGCCGCGTTATATACT CATCACCAATACATCGCAGGATTCATCATGACAGGAGCTTTTGCTCATGGAGCTATATTTTTTATTAGAGATTACAATCC GGAACAGAACGAGAATAATGTATTGGCAAGAATGTTAGACCATAAAGAAGCTATCATATCCCATTTAAGTTGGGCTAGCC TCTTTCTGGGATTCCATACTTTGGGACTTTATGTTCATAATGATGTTATGCTTGCTTTTGGTACTCCGGAGAAACAAATC TTGATCGAACCCATATTTGCCCAATGGATACAATCTGCTCACGGTAAAACTTCATATGGATTCGATGTACTTTTATCTTC AACGAATAGTGCAGCCTTCAATGCAGGTCGAAGCATATGGTTGCCCGGCTGGTTAAATGCTGTTAATGAAAATAGTAATT CATTATTCTTAACAATAGGGCCTGGAGACTTCTTGGTTCATCATGCTATTGCTCTAGGTTTACATACAACCACATTAATC TTAGTAAAAGGTGCTTTAGATGCACGTGGTTCGAAGTTAATGCCAGATAAAAAGGATTTTGGTTATAGTTTTCCTTGCGA TGGTCCGGGACGCGGTGGTACTTGTGATATTTCGGCTTGGGACGCATTTTATTTGGCGGTTTTCTGGATGTTAAATACCA TTGGATGGGTTACTTTTTATTGGCATTGGAAGCACATCACATTATGGCAGGGTAATGTTTCACAGTTTAATGAATCTTCC ACTTATTTGATGGGATGGTTAAGAGATTATCTATGGTTAAACTCTTCACAACTTATCAATGGATATAACCCTTTCGGTAT GAATAGCTTATCGGTCTGGGCGTGGATGTTCTTATTTGGACATCTTGTTTGGGCTACTGGATTTATGTTTTTAATTTCTT GGCGTGGATATTGGCAGGAATTGATTGAAACTTTAGCGTGGGCTCATGAACGTACGCCTTTGGCTAATTTGATTCGATGG AGAGATAAACCAGTAGCTCTTTCCATTGTGCAAGCAAGATTGGTTGGATTAGCCCACTTTTCTGTAGGTTATATCTTCAC TTATGCGGCTTTCTTGATTGCCTCTACATCAGGTAAATTTGGTTA
Gene structure

JCDB Genes gff download

JCDBG00033 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00033's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00033JCDBG00026co-exp0.950075
JCDBG00033JCDBG00027co-exp0.935167
JCDBG00033JCDBG00034co-exp0.902027
JCDBG00033JCDBG00071co-exp0.899852
JCDBG00033JCDBG00002co-exp0.899406
JCDBG00033JCDBG00047co-exp0.885043
JCDBG00033JCDBG00067co-exp0.87946
JCDBG00033JCDBG03794co-exp0.856116
JCDBG00033JCDBG08355co-exp0.846076
JCDBG00033JCDBG09070co-exp0.843744
JCDBG00026JCDBG00027co-exp0.967986
JCDBG00026JCDBG00034co-exp0.863772
JCDBG00026JCDBG00071co-exp0.934561
JCDBG00026JCDBG00002co-exp0.926188
JCDBG00026JCDBG00047co-exp0.916383
JCDBG00026JCDBG00067co-exp0.902249
JCDBG00026JCDBG03794co-exp0.798847
JCDBG00026JCDBG08355co-exp0.794646
JCDBG00026JCDBG09070co-exp0.796382
JCDBG00027JCDBG00034co-exp0.884364
JCDBG00027JCDBG00071co-exp0.925427
JCDBG00027JCDBG00002co-exp0.921385
JCDBG00027JCDBG00047co-exp0.913089
JCDBG00027JCDBG00067co-exp0.928913
JCDBG00027JCDBG03794co-exp0.830709
JCDBG00027JCDBG08355co-exp0.849217
JCDBG00027JCDBG09070co-exp0.82692
JCDBG00034JCDBG00071co-exp0.815403
JCDBG00034JCDBG00002co-exp0.816051
JCDBG00034JCDBG00047co-exp0.836956
JCDBG00034JCDBG00067co-exp0.84116
JCDBG00034JCDBG03794co-exp0.774217
JCDBG00034JCDBG08355co-exp0.782552
JCDBG00034JCDBG09070co-exp0.768955
JCDBG00071JCDBG00002co-exp0.893332
JCDBG00071JCDBG00047co-exp0.937953
JCDBG00071JCDBG00067co-exp0.921919
JCDBG00071JCDBG03794co-exp0.743885
JCDBG00071JCDBG08355co-exp0.766407
JCDBG00071JCDBG09070co-exp0.758388
JCDBG00002JCDBG00047co-exp0.867959
JCDBG00002JCDBG00067co-exp0.859833
JCDBG00002JCDBG03794co-exp0.807003
JCDBG00002JCDBG08355co-exp0.792358
JCDBG00002JCDBG09070co-exp0.791154
JCDBG00047JCDBG00067co-exp0.923353
JCDBG00047JCDBG03794co-exp0.71008
JCDBG00047JCDBG08355co-exp0.754028
JCDBG00047JCDBG09070co-exp0.751245
JCDBG00067JCDBG03794co-exp0.754753
JCDBG00067JCDBG08355co-exp0.80333
JCDBG00067JCDBG09070co-exp0.806836
JCDBG03794JCDBG08355co-exp0.91014
JCDBG03794JCDBG09070co-exp0.923705
JCDBG08355JCDBG09070co-exp0.921813
PPI network
node1node2type
JCDBR00033
ID
JCDBR00033
Name
psaB
Type
protein_coding
Scaffold
NC_012224.1
Start
42314
End
44518
Strand
-
Exon
42314-44518
Sequence
TATGGCATTAAGATTTCCAAGGTTTAGCCAAGGCTTAGCTCAGGACCCCACTACTCGTCGTATTTGGTTTGGTATTGCTA CCGCACATGACTTCGAGAGTCATGATGATATTACGGAGGAACGGCTTTATCAGAATATTTTTGCTTCCCACTTCGGACAA TTAGCAATAATTTTTCTGTGGACTTCCGGAAATCTCTTTCATGTAGCTTGGCAAGGAAATTTTGAAGCATGGGTACAGGA CCCTTTACACGTAAGACCTATTGCTCATGCAATTTGGGATCCTCATTTTGGCCAACCGGCCGTGGAAGCTTTTACTCGAG GGGGCGCCCCTGGCCCAGTGAATATCGCTTATTCTGGTGTTTATCAATGGTGGTATACAATCGGTTTACGTACTAACGAA GATCTTTATATTGGAGCTCTTTTTCTATTATTTCTTTCTGCCCTAGCCTTATTAGGGGGTTGGTTACACCTACAACCGAA ATGGAAACCGAGCGTTTCGTGGTTCAAAAACGCCGAATCTCGTCTCAATCATCATTTGTCGGGACTATTCGGAGTAAGCT CTTTAGCTTGGACAGGACATTTAGTCCATGTCGCTATTCCTGGTTCCAGGGGCGAATACGTTCGATGGAATAATTTCTTA GATGTATTACCCCATCCCCAAGGATTAGGCCCCCTTTTTACAGGTCAGTGGAATCTTTATGCTCAAAATCCCGATTCAGG TAGTCATTTATTTGGTACCTCCCAAGGATCAGGAACTGCCATTCTAACCCTTCTCGGGGGGTTCCATCCACAAACACAAA GTTTATGGCTGACCGATATTGCACACCATCATTTAGCTATTGCATTTCTTTTTCTCGTTGCCGGTCATATGTATAGAACT AACTTCGGGATTGGGCACAGTATAAAAGATCTTTTAGAAGCACATATTCCTCCCGGGGGGCGATTGGGGAGTGGACATAA GGGTCTTTATGACACAATCAACAATTCGCTTCATTTTCAATTAGGCCTTGCTCTAGCTTCTTTAGGGGTTATTACTTCCT TAGTAGCTCAACACATGTACTCATTACCTGCTTATGCATTCATAGCGCAAGACTTTACTACTCAAGCCGCGTTATATACT CATCACCAATACATCGCAGGATTCATCATGACAGGAGCTTTTGCTCATGGAGCTATATTTTTTATTAGAGATTACAATCC GGAACAGAACGAGAATAATGTATTGGCAAGAATGTTAGACCATAAAGAAGCTATCATATCCCATTTAAGTTGGGCTAGCC TCTTTCTGGGATTCCATACTTTGGGACTTTATGTTCATAATGATGTTATGCTTGCTTTTGGTACTCCGGAGAAACAAATC TTGATCGAACCCATATTTGCCCAATGGATACAATCTGCTCACGGTAAAACTTCATATGGATTCGATGTACTTTTATCTTC AACGAATAGTGCAGCCTTCAATGCAGGTCGAAGCATATGGTTGCCCGGCTGGTTAAATGCTGTTAATGAAAATAGTAATT CATTATTCTTAACAATAGGGCCTGGAGACTTCTTGGTTCATCATGCTATTGCTCTAGGTTTACATACAACCACATTAATC TTAGTAAAAGGTGCTTTAGATGCACGTGGTTCGAAGTTAATGCCAGATAAAAAGGATTTTGGTTATAGTTTTCCTTGCGA TGGTCCGGGACGCGGTGGTACTTGTGATATTTCGGCTTGGGACGCATTTTATTTGGCGGTTTTCTGGATGTTAAATACCA TTGGATGGGTTACTTTTTATTGGCATTGGAAGCACATCACATTATGGCAGGGTAATGTTTCACAGTTTAATGAATCTTCC ACTTATTTGATGGGATGGTTAAGAGATTATCTATGGTTAAACTCTTCACAACTTATCAATGGATATAACCCTTTCGGTAT GAATAGCTTATCGGTCTGGGCGTGGATGTTCTTATTTGGACATCTTGTTTGGGCTACTGGATTTATGTTTTTAATTTCTT GGCGTGGATATTGGCAGGAATTGATTGAAACTTTAGCGTGGGCTCATGAACGTACGCCTTTGGCTAATTTGATTCGATGG AGAGATAAACCAGTAGCTCTTTCCATTGTGCAAGCAAGATTGGTTGGATTAGCCCACTTTTCTGTAGGTTATATCTTCAC TTATGCGGCTTTCTTGATTGCCTCTACATCAGGTAAATTTGGTTA
Product
Source
RefSeq
Link:
JCDBP00019
ID
JCDBP00019
Parent
JCDBR00033
Name
YP_002720111.1
Scaffold
NC_012224.1
CDS
42314-44518
Strand:
-
Sequence
MALRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFEAWVQD PLHVRPIAHAIWDPHFGQPAVEAFTRGGAPGPVNIAYSGVYQWWYTIGLRTNEDLYIGALFLLFLSALALLGGWLHLQPK WKPSVSWFKNAESRLNHHLSGLFGVSSLAWTGHLVHVAIPGSRGEYVRWNNFLDVLPHPQGLGPLFTGQWNLYAQNPDSG SHLFGTSQGSGTAILTLLGGFHPQTQSLWLTDIAHHHLAIAFLFLVAGHMYRTNFGIGHSIKDLLEAHIPPGGRLGSGHK GLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNP EQNENNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSS TNSAAFNAGRSIWLPGWLNAVNENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCD GPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGM NSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLAHFSVGYIFT YAAFLIASTSGKFG
Product
photosystem I P700 chlorophyll a apoprotein A2
Source
RefSeq
Link
YP_002720111.1
InterProScan
IPR001280 Photosystem I PsaA/PsaB
IPR006244 Photosystem I PsaB
IPR020586 Photosystem I PsaA/PsaB, conserved site
Pfam
PF00223.15 PsaA_PsaB Family