Detail information of JCDBG00035

JCDBG00035
ID
JCDBG00035
Name
ycf3
Type
protein_coding
Scaffold
NC_012224.1
Start
47666
End
49549
Strand
-
Link
Genbank id:7564857
Molecular function
GO:0005515 | protein binding
Cellular component
Biological process
KEGG
Source
RefSeq
TF
Description
Sequence
TATGCCTAGATCCCGGACAACTGGAAATTTTATTGATAAGACCTTTTCAATTGTAGCCAATATCTTATTACGAATAATTC CAACAACTTCGGGAGAAAAAGAGGCATTTACTTATTACAGAGATGGTGTGATTTGATTTTTTTTTATTTACCACCTCAAG TCTTAGGAGAAAGACACATTAGTCGGGATAGAAAGATTTGAAATAACTCTACGCTTGTTGAAGGTGAAGTTTATCGGTTT ATAAATAAAAAATCCCTTCTGTCGGGTATCCTCGATTAATGCAGCCTCAGATGCTTCAATTGTCAATTCTAGCATTGAAC GAAAGGTTACACCTATGGCTACGGGTTCTGTATTGCAGGTTAACCCTACCCTACTAGTACCAATAGGCGACATAGAGGAA GAAGCACTACGCCTAGGAATCAACAACACGAAAACTTTGTTAGAAATTATCCCTTTTCTTTATTTGGATCGGGACTAAGA AGAATGGTTGGGACAACAAGCATCCATCTCGTTTGTACTTTGGATACCCGTATAACCATCGAAGATCGTTGAAGTGACTA ATTCCTAGAAATTAAAGAAGATTGAGGACAAAGAAATTGTTGAAGTTAACTTAATATTTTTATCTAGTATCAACATGCTT GATGTTAAGAAAAAATCTTTTGCAGGAGGGTTGGCTAGAGATTTCTTGTAAAAACACTAGCCCCGCTCAGTTCATTATGT ATTATTCTCATTATGCACATAAGGGAGGAGCCGTATGAGATGAAAATCTCACGTACGGTTCTGGAACGGAGATTCTTTGA ATCGAATGACGACCGTAACGAATGTCTGCTCAATCCGAAGGAAATTATGCAGAAGCTTTACAGAATTATTATGAAGCTTT GCGGCTAGAAATTGATCCCTATGATCGAAGTTATATACTCTATAATATAGGCCTTATTCACACAAGTAATGGAGAACACA CAAAAGCTTTGGAATATTATTTTCGGGCACTAGAACGAAACCCCTTCTTACCACAAGCTTTAAATAATATGGCCGTGATC TGTCATTACGTGCGACTATCTCCACTATAGAAAGAAAAAAGAAAAAAAAAAGAAAAATTGAATAGGCTTTCTACATATGC ATCGTCCAAAACAACGATTTTTATCAGCTGTAGTAAAGAAAGCAACTTCATAGAAGTCAAAATATGAAGAAAAAAATGTC TAGATACTTTATTCTATGGATAAAGGATCTAATTGATAGAGGAAGCATCGTAAAGATCAATTAGCGAGATTTTTGGCCGA TACAATAAGAACTGCTTACTTATGTCATAATATGAGACAAAAGTTAGGAATCAACTTATGTAACAGAGTTGATCTCCTAA AGTATTGAGCAGCGGTGTAGCATCAGATCCCAAAGAGAGTAAGTCTTTCTTTTGAGGGAAGGTCTTTTTCAAAGATTCTA TATATATTTATATATAAAAATAGAAAAATAAAAATAGAAAACCGGGATAGTTACCTTTCAGAAAATTCTAACGATAGTAG AACGCATACGCTTTATTCTTCTGAAGGTGGGAGAAAAGATAAAACTGATTATTAATCAAAATTCAAGTTTGAAACTCATC TAATTAACCTTTTTTGGTTAACTCGAGAAAAAATAAAAAACGGGACACCAAAAGAATTGACTGCTGAGCCGTATGAGGTA GGAAACTCTCAAGTACGGTTCTAATGGAAGGAATTTGCTCGCCTATTCTGACCGAGGAGAACAGGCCATTCGGCAGGGAG ATTCTGAAATTGCGGAAGCTTGGTTCGATCAAGCCGCGGAGTATTGGAAACAAGCTATAGCGCTTACTCCCGGAAATTAT ATTGAAGCGCAGAATTGGTTGAAGATCACAAGGCGTTTCGAATA
Gene structure

JCDB Genes gff download

JCDBG00035 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00035's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00035JCDBG13317co-exp0.819984
JCDBG00035JCDBG11370co-exp0.669634
JCDBG13317JCDBG11370co-exp0.819984
PPI network
node1node2type
JCDBR00035
ID
JCDBR00035
Name
ycf3
Type
protein_coding
Scaffold
NC_012224.1
Start
47666
End
49549
Strand
-
Exon
47666-47815,48502-48729,49421-49549
Sequence
TATGCCTAGATCCCGGACAACTGGAAATTTTATTGATAAGACCTTTTCAATTGTAGCCAATATCTTATTACGAATAATTC CAACAACTTCGGGAGAAAAAGAGGCATTTACTTATTACAGAGATGGTGTGATTTGATTTTTTTTTATTTACCACCTCAAG TCTTAGGAGAAAGACACATTAGTCGGGATAGAAAGATTTGAAATAACTCTACGCTTGTTGAAGGTGAAGTTTATCGGTTT ATAAATAAAAAATCCCTTCTGTCGGGTATCCTCGATTAATGCAGCCTCAGATGCTTCAATTGTCAATTCTAGCATTGAAC GAAAGGTTACACCTATGGCTACGGGTTCTGTATTGCAGGTTAACCCTACCCTACTAGTACCAATAGGCGACATAGAGGAA GAAGCACTACGCCTAGGAATCAACAACACGAAAACTTTGTTAGAAATTATCCCTTTTCTTTATTTGGATCGGGACTAAGA AGAATGGTTGGGACAACAAGCATCCATCTCGTTTGTACTTTGGATACCCGTATAACCATCGAAGATCGTTGAAGTGACTA ATTCCTAGAAATTAAAGAAGATTGAGGACAAAGAAATTGTTGAAGTTAACTTAATATTTTTATCTAGTATCAACATGCTT GATGTTAAGAAAAAATCTTTTGCAGGAGGGTTGGCTAGAGATTTCTTGTAAAAACACTAGCCCCGCTCAGTTCATTATGT ATTATTCTCATTATGCACATAAGGGAGGAGCCGTATGAGATGAAAATCTCACGTACGGTTCTGGAACGGAGATTCTTTGA ATCGAATGACGACCGTAACGAATGTCTGCTCAATCCGAAGGAAATTATGCAGAAGCTTTACAGAATTATTATGAAGCTTT GCGGCTAGAAATTGATCCCTATGATCGAAGTTATATACTCTATAATATAGGCCTTATTCACACAAGTAATGGAGAACACA CAAAAGCTTTGGAATATTATTTTCGGGCACTAGAACGAAACCCCTTCTTACCACAAGCTTTAAATAATATGGCCGTGATC TGTCATTACGTGCGACTATCTCCACTATAGAAAGAAAAAAGAAAAAAAAAAGAAAAATTGAATAGGCTTTCTACATATGC ATCGTCCAAAACAACGATTTTTATCAGCTGTAGTAAAGAAAGCAACTTCATAGAAGTCAAAATATGAAGAAAAAAATGTC TAGATACTTTATTCTATGGATAAAGGATCTAATTGATAGAGGAAGCATCGTAAAGATCAATTAGCGAGATTTTTGGCCGA TACAATAAGAACTGCTTACTTATGTCATAATATGAGACAAAAGTTAGGAATCAACTTATGTAACAGAGTTGATCTCCTAA AGTATTGAGCAGCGGTGTAGCATCAGATCCCAAAGAGAGTAAGTCTTTCTTTTGAGGGAAGGTCTTTTTCAAAGATTCTA TATATATTTATATATAAAAATAGAAAAATAAAAATAGAAAACCGGGATAGTTACCTTTCAGAAAATTCTAACGATAGTAG AACGCATACGCTTTATTCTTCTGAAGGTGGGAGAAAAGATAAAACTGATTATTAATCAAAATTCAAGTTTGAAACTCATC TAATTAACCTTTTTTGGTTAACTCGAGAAAAAATAAAAAACGGGACACCAAAAGAATTGACTGCTGAGCCGTATGAGGTA GGAAACTCTCAAGTACGGTTCTAATGGAAGGAATTTGCTCGCCTATTCTGACCGAGGAGAACAGGCCATTCGGCAGGGAG ATTCTGAAATTGCGGAAGCTTGGTTCGATCAAGCCGCGGAGTATTGGAAACAAGCTATAGCGCTTACTCCCGGAAATTAT ATTGAAGCGCAGAATTGGTTGAAGATCACAAGGCGTTTCGAATA
Product
Source
RefSeq
Link:
JCDBP00021
ID
JCDBP00021
Parent
JCDBR00035
Name
YP_002720113.1
Scaffold
NC_012224.1
CDS
47666-47815,48502-48729,49421-49549
Strand:
-
Sequence
MPRSRTTGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGVMSAQSEGNYAEALQNYYEALRLEIDPYDRSYILYNIG LIHTSNGEHTKALEYYFRALERNPFLPQALNNMAVICHYGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAQNW LKITRRFE
Product
photosystem I assembly protein Ycf3
Source
RefSeq
Link
YP_002720113.1
InterProScan
IPR001440 Tetratricopeptide repeat 1
IPR011990 Tetratricopeptide-like helical domain
IPR013026 Tetratricopeptide repeat-containing domain
IPR019734 Tetratricopeptide repeat
IPR022818 Photosystem I Ycf3, assembly
Pfam
PF13414.2 TPR_11 Repeat
PF07719.13 TPR_2 Repeat