Detail information of JCDBG00037

JCDBG00037
ID
JCDBG00037
Name
rps4
Type
protein_coding
Scaffold
NC_012224.1
Start
50193
End
50798
Strand
-
Link
Genbank id:7564859
Molecular function
GO:0003723 | RNA binding
GO:0003735 | structural constituent of ribosome
GO:0019843 | rRNA binding
Cellular component
GO:0005622 | intracellular
GO:0015935 | small ribosomal subunit
Biological process
GO:0006412 | translation
KEGG
Entry: K02986
Name: RP-S4, rpsD
Definition: small subunit ribosomal protein S4
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
TATGTCACGTTACCGAGGGCCTCGTTTCAAAAAAATACGCCGTCTCGGGGCTTTACCGGGACTAACTAGTAAAAGGCCTA GAGCCGGGAGCGATCTTAGAAATCAATCACGCTCCGGTAAAAAATCTCAATATCGTATTCGTTTAGAAGAAAAGCAAAAA TTACGTTTTCATTATGGTCTTACAGAACGACAATTGCTTAAATACGTTCGTATCGCCGCAAAAGCCAAAGGGTCAACGGG TCAGGTTTTACTACAATTACTTGAAATGCGGTTGGATAACATCCTTTTTCGATTGGGTATAGCGTCAACTATTCCTCGAG CCCGCCAATTAGTTAATCATAGACATATTTTAGTTAATGGCCGTATAGTAGATATACCAAGTTATCGCTGCAAACCCCGA GATGTTATTACAGTGAGGGATGAACAAAAATCTAGAGCTATGATTCCAAATTATCTTGATTCATCCCCCCAAGAGGAATT GCCAAAACATTTGACTCTTCACCCAATCCAATATAAAGGATTGGTCAATCAAATAATAGATAGTAAATGGGGTGGCTTAA AAATAAATGAATTGCTAGTGGTAGAATATTATTCTCGTCAGACTTA
Gene structure

JCDB Genes gff download

JCDBG00037 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00037's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00037JCDBG00063co-exp0.966339
JCDBG00037JCDBG00012co-exp0.963833
JCDBG00037JCDBG00065co-exp0.962165
JCDBG00037JCDBG00112co-exp0.958141
JCDBG00037JCDBG00046co-exp0.956923
JCDBG00037JCDBG11239co-exp0.943379
JCDBG00037JCDBG00070co-exp0.943138
JCDBG00037JCDBG00075co-exp0.939222
JCDBG00037JCDBG00062co-exp0.934869
JCDBG00037JCDBG07355co-exp0.930475
JCDBG00063JCDBG00012co-exp0.938615
JCDBG00063JCDBG00065co-exp0.942622
JCDBG00063JCDBG00112co-exp0.929563
JCDBG00063JCDBG00046co-exp0.932346
JCDBG00063JCDBG11239co-exp0.950032
JCDBG00063JCDBG00070co-exp0.952478
JCDBG00063JCDBG00075co-exp0.953019
JCDBG00063JCDBG00062co-exp0.914786
JCDBG00063JCDBG07355co-exp0.927425
JCDBG00012JCDBG00065co-exp0.946607
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG00046co-exp0.949104
JCDBG00012JCDBG11239co-exp0.912939
JCDBG00012JCDBG00070co-exp0.911621
JCDBG00012JCDBG00075co-exp0.912519
JCDBG00012JCDBG00062co-exp0.910668
JCDBG00012JCDBG07355co-exp0.91033
JCDBG00065JCDBG00112co-exp0.944148
JCDBG00065JCDBG00046co-exp0.954196
JCDBG00065JCDBG11239co-exp0.91345
JCDBG00065JCDBG00070co-exp0.908277
JCDBG00065JCDBG00075co-exp0.920844
JCDBG00065JCDBG00062co-exp0.946062
JCDBG00065JCDBG07355co-exp0.934898
JCDBG00112JCDBG00046co-exp0.924872
JCDBG00112JCDBG11239co-exp0.919971
JCDBG00112JCDBG00070co-exp0.886046
JCDBG00112JCDBG00075co-exp0.92744
JCDBG00112JCDBG00062co-exp0.902815
JCDBG00112JCDBG07355co-exp0.887364
JCDBG00046JCDBG11239co-exp0.899265
JCDBG00046JCDBG00070co-exp0.918786
JCDBG00046JCDBG00075co-exp0.886163
JCDBG00046JCDBG00062co-exp0.908979
JCDBG00046JCDBG07355co-exp0.936736
JCDBG11239JCDBG00070co-exp0.898642
JCDBG11239JCDBG00075co-exp0.952265
JCDBG11239JCDBG00062co-exp0.888295
JCDBG11239JCDBG07355co-exp0.874631
JCDBG00070JCDBG00075co-exp0.901847
JCDBG00070JCDBG00062co-exp0.90613
JCDBG00070JCDBG07355co-exp0.909479
JCDBG00075JCDBG00062co-exp0.905767
JCDBG00075JCDBG07355co-exp0.851933
JCDBG00062JCDBG07355co-exp0.891163
PPI network
node1node2type
JCDBG00037JCDBG24182PPI
JCDBG00037JCDBG16654PPI
JCDBG00037JCDBG09324PPI
JCDBG00037JCDBG14958PPI
JCDBG00037JCDBG17434PPI
JCDBG00037JCDBG21369PPI
JCDBG00037JCDBG12829PPI
JCDBG00037JCDBG01351PPI
JCDBG00037JCDBG14028PPI
JCDBG00037JCDBG23530PPI
JCDBG00037JCDBG09611PPI
JCDBG00037JCDBG20518PPI
JCDBG00037JCDBG08740PPI
JCDBG00037JCDBG05191PPI
JCDBG00037JCDBG23880PPI
JCDBG00037JCDBG15243PPI
JCDBG00037JCDBG13802PPI
JCDBG00037JCDBG10921PPI
JCDBG00037JCDBG20140PPI
JCDBG00037JCDBG23997PPI
JCDBG00037JCDBG08056PPI
JCDBG00037JCDBG03794PPI
JCDBG00037JCDBG08746PPI
JCDBG00037JCDBG18267PPI
JCDBG00037JCDBG23469PPI
JCDBG00037JCDBG08044PPI
JCDBG00037JCDBG10333PPI
JCDBG00037JCDBG24155PPI
JCDBG00037JCDBG05294PPI
JCDBG00037JCDBG17129PPI
JCDBG00037JCDBG13218PPI
JCDBG00037JCDBG23270PPI
JCDBG00037JCDBG08468PPI
JCDBG00037JCDBG08163PPI
JCDBG00037JCDBG13730PPI
JCDBG00037JCDBG22653PPI
JCDBG00037JCDBG08991PPI
JCDBG00037JCDBG00306PPI
JCDBG00037JCDBG00558PPI
JCDBG00037JCDBG02034PPI
JCDBG00037JCDBG08804PPI
JCDBG00037JCDBG17892PPI
JCDBG00037JCDBG08795PPI
JCDBG00037JCDBG11675PPI
JCDBG00037JCDBG19936PPI
JCDBG00037JCDBG20749PPI
JCDBG00037JCDBG22869PPI
JCDBG00037JCDBG18629PPI
JCDBG00037JCDBG16005PPI
JCDBG00037JCDBG23113PPI
JCDBG00037JCDBG09698PPI
JCDBG00037JCDBG18419PPI
JCDBG00037JCDBG02680PPI
JCDBG00037JCDBG08310PPI
JCDBG00037JCDBG03587PPI
JCDBG00037JCDBG12412PPI
JCDBG24182JCDBG16654PPI
JCDBG24182JCDBG09324PPI
JCDBG24182JCDBG14958PPI
JCDBG24182JCDBG17434PPI
JCDBG24182JCDBG21369PPI
JCDBG24182JCDBG23530PPI
JCDBG24182JCDBG09611PPI
JCDBG24182JCDBG05191PPI
JCDBG24182JCDBG23880PPI
JCDBG24182JCDBG13802PPI
JCDBG24182JCDBG20140PPI
JCDBG24182JCDBG23997PPI
JCDBG24182JCDBG08056PPI
JCDBG24182JCDBG03794PPI
JCDBG24182JCDBG23469PPI
JCDBG24182JCDBG08044PPI
JCDBG24182JCDBG05294PPI
JCDBG24182JCDBG17129PPI
JCDBG24182JCDBG13218PPI
JCDBG24182JCDBG08468PPI
JCDBG24182JCDBG22653PPI
JCDBG24182JCDBG00306PPI
JCDBG24182JCDBG00558PPI
JCDBG24182JCDBG19936PPI
JCDBG24182JCDBG16005PPI
JCDBG24182JCDBG23113PPI
JCDBG24182JCDBG18419PPI
JCDBG24182JCDBG02680PPI
JCDBG24182JCDBG03587PPI
JCDBG16654JCDBG23530PPI
JCDBG16654JCDBG23880PPI
JCDBG16654JCDBG15243PPI
JCDBG16654JCDBG13802PPI
JCDBG16654JCDBG03794PPI
JCDBG16654JCDBG23469PPI
JCDBG16654JCDBG08163PPI
JCDBG16654JCDBG00306PPI
JCDBG16654JCDBG23113PPI
JCDBG16654JCDBG18419PPI
JCDBG16654JCDBG03587PPI
JCDBG09324JCDBG14958PPI
JCDBG09324JCDBG23880PPI
JCDBG09324JCDBG13802PPI
JCDBG09324JCDBG03794PPI
JCDBG09324JCDBG00306PPI
JCDBG09324JCDBG23113PPI
JCDBG14958JCDBG23880PPI
JCDBG14958JCDBG13802PPI
JCDBG14958JCDBG03794PPI
JCDBG14958JCDBG00306PPI
JCDBG14958JCDBG23113PPI
JCDBG17434JCDBG23530PPI
JCDBG17434JCDBG23880PPI
JCDBG17434JCDBG23469PPI
JCDBG17434JCDBG00306PPI
JCDBG17434JCDBG19936PPI
JCDBG17434JCDBG23113PPI
JCDBG17434JCDBG18419PPI
JCDBG21369JCDBG23530PPI
JCDBG21369JCDBG23880PPI
JCDBG12829JCDBG23997PPI
JCDBG12829JCDBG00306PPI
JCDBG12829JCDBG19936PPI
JCDBG12829JCDBG23113PPI
JCDBG14028JCDBG13802PPI
JCDBG14028JCDBG13218PPI
JCDBG14028JCDBG00306PPI
JCDBG14028JCDBG02034PPI
JCDBG14028JCDBG23113PPI
JCDBG23530JCDBG08740PPI
JCDBG23530JCDBG23880PPI
JCDBG23530JCDBG13802PPI
JCDBG23530JCDBG03794PPI
JCDBG23530JCDBG23469PPI
JCDBG23530JCDBG22653PPI
JCDBG23530JCDBG00306PPI
JCDBG23530JCDBG00558PPI
JCDBG23530JCDBG19936PPI
JCDBG23530JCDBG23113PPI
JCDBG23530JCDBG09698PPI
JCDBG23530JCDBG18419PPI
JCDBG23530JCDBG03587PPI
JCDBG09611JCDBG05191PPI
JCDBG09611JCDBG23880PPI
JCDBG09611JCDBG20140PPI
JCDBG09611JCDBG03794PPI
JCDBG08740JCDBG19936PPI
JCDBG05191JCDBG23880PPI
JCDBG05191JCDBG03794PPI
JCDBG23880JCDBG15243PPI
JCDBG23880JCDBG13802PPI
JCDBG23880JCDBG20140PPI
JCDBG23880JCDBG23997PPI
JCDBG23880JCDBG03794PPI
JCDBG23880JCDBG08746PPI
JCDBG23880JCDBG23469PPI
JCDBG23880JCDBG08044PPI
JCDBG23880JCDBG17129PPI
JCDBG23880JCDBG08468PPI
JCDBG23880JCDBG08163PPI
JCDBG23880JCDBG13730PPI
JCDBG23880JCDBG22653PPI
JCDBG23880JCDBG08991PPI
JCDBG23880JCDBG00558PPI
JCDBG23880JCDBG17892PPI
JCDBG23880JCDBG19936PPI
JCDBG23880JCDBG20749PPI
JCDBG23880JCDBG22869PPI
JCDBG23880JCDBG08310PPI
JCDBG23880JCDBG03587PPI
JCDBG15243JCDBG03794PPI
JCDBG15243JCDBG23469PPI
JCDBG15243JCDBG00306PPI
JCDBG15243JCDBG23113PPI
JCDBG15243JCDBG18419PPI
JCDBG15243JCDBG08310PPI
JCDBG13802JCDBG23997PPI
JCDBG13802JCDBG23469PPI
JCDBG13802JCDBG08468PPI
JCDBG13802JCDBG08991PPI
JCDBG13802JCDBG19936PPI
JCDBG13802JCDBG22869PPI
JCDBG13802JCDBG02680PPI
JCDBG13802JCDBG03587PPI
JCDBG20140JCDBG03794PPI
JCDBG20140JCDBG22653PPI
JCDBG20140JCDBG18419PPI
JCDBG23997JCDBG03794PPI
JCDBG23997JCDBG00306PPI
JCDBG23997JCDBG23113PPI
JCDBG03794JCDBG08746PPI
JCDBG03794JCDBG23469PPI
JCDBG03794JCDBG17129PPI
JCDBG03794JCDBG22653PPI
JCDBG03794JCDBG08991PPI
JCDBG03794JCDBG00558PPI
JCDBG03794JCDBG19936PPI
JCDBG03794JCDBG20749PPI
JCDBG03794JCDBG22869PPI
JCDBG03794JCDBG09698PPI
JCDBG03794JCDBG18419PPI
JCDBG03794JCDBG03587PPI
JCDBG08746JCDBG00306PPI
JCDBG08746JCDBG19936PPI
JCDBG08746JCDBG23113PPI
JCDBG23469JCDBG00558PPI
JCDBG23469JCDBG19936PPI
JCDBG23469JCDBG18419PPI
JCDBG23469JCDBG03587PPI
JCDBG08044JCDBG00306PPI
JCDBG08044JCDBG23113PPI
JCDBG08044JCDBG18419PPI
JCDBG17129JCDBG18419PPI
JCDBG23270JCDBG08991PPI
JCDBG08468JCDBG00306PPI
JCDBG08468JCDBG23113PPI
JCDBG08468JCDBG09698PPI
JCDBG08468JCDBG18419PPI
JCDBG08468JCDBG03587PPI
JCDBG08163JCDBG00306PPI
JCDBG08163JCDBG19936PPI
JCDBG08163JCDBG23113PPI
JCDBG22653JCDBG03587PPI
JCDBG08991JCDBG00306PPI
JCDBG08991JCDBG19936PPI
JCDBG08991JCDBG23113PPI
JCDBG08991JCDBG08310PPI
JCDBG00306JCDBG00558PPI
JCDBG00306JCDBG11675PPI
JCDBG00306JCDBG22869PPI
JCDBG00306JCDBG18419PPI
JCDBG00306JCDBG02680PPI
JCDBG00306JCDBG03587PPI
JCDBG00306JCDBG12412PPI
JCDBG00558JCDBG19936PPI
JCDBG00558JCDBG23113PPI
JCDBG11675JCDBG19936PPI
JCDBG11675JCDBG16005PPI
JCDBG11675JCDBG23113PPI
JCDBG19936JCDBG22869PPI
JCDBG19936JCDBG18629PPI
JCDBG19936JCDBG18419PPI
JCDBG19936JCDBG02680PPI
JCDBG20749JCDBG02680PPI
JCDBG22869JCDBG23113PPI
JCDBG23113JCDBG18419PPI
JCDBG23113JCDBG02680PPI
JCDBG23113JCDBG03587PPI
JCDBG23113JCDBG12412PPI
JCDBG09698JCDBG03587PPI
JCDBG18419JCDBG03587PPI
JCDBR00037
ID
JCDBR00037
Name
rps4
Type
protein_coding
Scaffold
NC_012224.1
Start
50193
End
50798
Strand
-
Exon
50193-50798
Sequence
TATGTCACGTTACCGAGGGCCTCGTTTCAAAAAAATACGCCGTCTCGGGGCTTTACCGGGACTAACTAGTAAAAGGCCTA GAGCCGGGAGCGATCTTAGAAATCAATCACGCTCCGGTAAAAAATCTCAATATCGTATTCGTTTAGAAGAAAAGCAAAAA TTACGTTTTCATTATGGTCTTACAGAACGACAATTGCTTAAATACGTTCGTATCGCCGCAAAAGCCAAAGGGTCAACGGG TCAGGTTTTACTACAATTACTTGAAATGCGGTTGGATAACATCCTTTTTCGATTGGGTATAGCGTCAACTATTCCTCGAG CCCGCCAATTAGTTAATCATAGACATATTTTAGTTAATGGCCGTATAGTAGATATACCAAGTTATCGCTGCAAACCCCGA GATGTTATTACAGTGAGGGATGAACAAAAATCTAGAGCTATGATTCCAAATTATCTTGATTCATCCCCCCAAGAGGAATT GCCAAAACATTTGACTCTTCACCCAATCCAATATAAAGGATTGGTCAATCAAATAATAGATAGTAAATGGGGTGGCTTAA AAATAAATGAATTGCTAGTGGTAGAATATTATTCTCGTCAGACTTA
Product
Source
RefSeq
Link:
JCDBP00022
ID
JCDBP00022
Parent
JCDBR00037
Name
YP_002720114.1
Scaffold
NC_012224.1
CDS
50193-50798
Strand:
-
Sequence
MSRYRGPRFKKIRRLGALPGLTSKRPRAGSDLRNQSRSGKKSQYRIRLEEKQKLRFHYGLTERQLLKYVRIAAKAKGSTG QVLLQLLEMRLDNILFRLGIASTIPRARQLVNHRHILVNGRIVDIPSYRCKPRDVITVRDEQKSRAMIPNYLDSSPQEEL PKHLTLHPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT
Product
ribosomal protein S4
Source
RefSeq
Link
YP_002720114.1
InterProScan
IPR001912 Ribosomal protein S4/S9, N-terminal
IPR002942 RNA-binding S4 domain
IPR005709 Ribosomal protein S4, bacterial-type
IPR018079 Ribosomal protein S4, conserved site
Pfam
PF00163.15 Ribosomal_S4 Family
PF01479.21 S4 Domain