Detail information of JCDBG00041

JCDBG00041
ID
JCDBG00041
Name
ndhJ
Type
protein_coding
Scaffold
NC_012224.1
Start
53707
End
54183
Strand
-
Link
Genbank id:7564863
Molecular function
GO:0016651 | oxidoreductase activity, acting on NAD(P)H
GO:0008137 | NADH dehydrogenase (ubiquinone) activity
Cellular component
Biological process
GO:0055114 | oxidation-reduction process
KEGG
Entry: K05581
Name: ndhJ
Definition: NAD(P)H-quinone oxidoreductase subunit J [EC:1.6.5.3]
ko00190:   Oxidative phosphorylation
Source
RefSeq
TF
Description
Sequence
GATGCAGGGTCGTTTGTCTGCTTGGCTAGTCAAACATGGGCTAGTTCATAGATCTTTGGGTTTTGATTACCAAGGAATAG AGACTTTACAAATAAAGCCCGAAGATTGGCATTCCATTGCTGTCATTTTATATGTATATGGTTACAATTATCTGCGTTCG CAATGTGCCTATGATGTAGCACCGGGCGGGCTGTTAGCTAGTGTATATCATCTTACGAGAATAGAGTATGGTATAGATCA ACCAGAAGAAGTATGTATAAAAGTATTTGCCCCAAGGAAGAATCCTAGAATTCCGTCTGTTTTCTGGGTTTGGAAAAGTG CGGATTTTCAAGAAAGGGAATCTTATGATATGCTGGGAATCTTTTATGATAATCATCCGCGTCTGAAACGTATCTTAATG CCGGAAAGTTGGGTAGGGTGGCCCTTACGTAAAGATTATATTGCTCCCAATTTTTATGAAATACAAGACGCTCATTG
Gene structure

JCDB Genes gff download

JCDBG00041 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00041's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00041JCDBG00011co-exp0.909905
JCDBG00041JCDBG00012co-exp0.854468
JCDBG00041JCDBG00018co-exp0.845236
JCDBG00041JCDBG00072co-exp0.831358
JCDBG00041JCDBG00021co-exp0.818802
JCDBG00041JCDBG00032co-exp0.816942
JCDBG00041JCDBG00046co-exp0.816192
JCDBG00041JCDBG00112co-exp0.811234
JCDBG00041JCDBG07881co-exp-0.810489
JCDBG00041JCDBG00037co-exp0.807298
JCDBG00011JCDBG00012co-exp0.834419
JCDBG00011JCDBG00018co-exp0.797195
JCDBG00011JCDBG00072co-exp0.837624
JCDBG00011JCDBG00021co-exp0.86141
JCDBG00011JCDBG00032co-exp0.788537
JCDBG00011JCDBG00046co-exp0.777465
JCDBG00011JCDBG00112co-exp0.812285
JCDBG00011JCDBG07881co-exp-0.764357
JCDBG00011JCDBG00037co-exp0.772141
JCDBG00012JCDBG00018co-exp0.626476
JCDBG00012JCDBG00072co-exp0.610987
JCDBG00012JCDBG00021co-exp0.880718
JCDBG00012JCDBG00032co-exp0.935341
JCDBG00012JCDBG00046co-exp0.949104
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG07881co-exp-0.900348
JCDBG00012JCDBG00037co-exp0.963833
JCDBG00018JCDBG00072co-exp0.789748
JCDBG00018JCDBG00021co-exp0.638963
JCDBG00018JCDBG00032co-exp0.630924
JCDBG00018JCDBG00046co-exp0.61404
JCDBG00018JCDBG00112co-exp0.613173
JCDBG00018JCDBG07881co-exp-0.60528
JCDBG00072JCDBG00021co-exp0.661652
JCDBG00072JCDBG07881co-exp-0.653414
JCDBG00021JCDBG00032co-exp0.813875
JCDBG00021JCDBG00046co-exp0.846811
JCDBG00021JCDBG00112co-exp0.864281
JCDBG00021JCDBG07881co-exp-0.817929
JCDBG00021JCDBG00037co-exp0.85541
JCDBG00032JCDBG00046co-exp0.945749
JCDBG00032JCDBG00112co-exp0.894441
JCDBG00032JCDBG07881co-exp-0.859654
JCDBG00032JCDBG00037co-exp0.917854
JCDBG00046JCDBG00112co-exp0.924872
JCDBG00046JCDBG07881co-exp-0.864564
JCDBG00046JCDBG00037co-exp0.956923
JCDBG00112JCDBG07881co-exp-0.877081
JCDBG00112JCDBG00037co-exp0.958141
JCDBG07881JCDBG00037co-exp-0.877803
PPI network
node1node2type
JCDBR00041
ID
JCDBR00041
Name
ndhJ
Type
protein_coding
Scaffold
NC_012224.1
Start
53707
End
54183
Strand
-
Exon
53707-54183
Sequence
GATGCAGGGTCGTTTGTCTGCTTGGCTAGTCAAACATGGGCTAGTTCATAGATCTTTGGGTTTTGATTACCAAGGAATAG AGACTTTACAAATAAAGCCCGAAGATTGGCATTCCATTGCTGTCATTTTATATGTATATGGTTACAATTATCTGCGTTCG CAATGTGCCTATGATGTAGCACCGGGCGGGCTGTTAGCTAGTGTATATCATCTTACGAGAATAGAGTATGGTATAGATCA ACCAGAAGAAGTATGTATAAAAGTATTTGCCCCAAGGAAGAATCCTAGAATTCCGTCTGTTTTCTGGGTTTGGAAAAGTG CGGATTTTCAAGAAAGGGAATCTTATGATATGCTGGGAATCTTTTATGATAATCATCCGCGTCTGAAACGTATCTTAATG CCGGAAAGTTGGGTAGGGTGGCCCTTACGTAAAGATTATATTGCTCCCAATTTTTATGAAATACAAGACGCTCATTG
Product
Source
RefSeq
Link:
JCDBP00023
ID
JCDBP00023
Parent
JCDBR00041
Name
YP_002720115.1
Scaffold
NC_012224.1
CDS
53707-54183
Strand:
-
Sequence
MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGIDQ PEEVCIKVFAPRKNPRIPSVFWVWKSADFQERESYDMLGIFYDNHPRLKRILMPESWVGWPLRKDYIAPNFYEIQDAH
Product
NADH dehydrogenase subunit J
Source
RefSeq
Link
YP_002720115.1
InterProScan
IPR001268 NADH:ubiquinone oxidoreductase, 30kDa subunit
IPR010218 NADH dehydrogenase, subunit C
IPR020396 NADH:ubiquinone oxidoreductase, 30kDa subunit, conserved site
Pfam
PF00329.15 Complex1_30kDa Family