Detail information of JCDBG00042

JCDBG00042
ID
JCDBG00042
Name
ndhK
Type
protein_coding
Scaffold
NC_012224.1
Start
54312
End
54989
Strand
-
Link
Genbank id:7564864
Molecular function
GO:0051539 | 4 iron, 4 sulfur cluster binding
GO:0048038 | quinone binding
GO:0051536 | iron-sulfur cluster binding
GO:0008137 | NADH dehydrogenase (ubiquinone) activity
Cellular component
Biological process
GO:0055114 | oxidation-reduction process
KEGG
Entry: K05582
Name: ndhK
Definition: NAD(P)H-quinone oxidoreductase subunit K [EC:1.6.5.3]
ko00190:   Oxidative phosphorylation
Source
RefSeq
TF
Description
Sequence
TATGAATTCCATTGAGTTTCCTTTACTTGATCAAACAACTAAAATTTCAGTTATTTCAACTACATCAAATGATCTTTCAA ATTGGTCAAGACTCTCCAGTTTATGGCCACTTCTCTATGGTACCAGTTGTTGCTTCATTGAATTTGCTTCGTTAATAGGC TCACGATTCGACTTTGATCGTTATGGACTAGTACCAAGATCTAGTCCTAGACAAGCGGACCTGATTTTAACAGCCGGCAC AGTAACCATGAAAATGGCTCCCTCTTTAGTGAGATTATATGAACAAATGCCAGAACCAAAATATGTTATTGCTATGGGGG CATGTACAATTACAGGGGGGATGTTCAGTACCGATTCTTATAGTACTGTTCGGGGAGTCGATAAGCTAATTCCTGTAGAT GTCTATTTGCCAGGCTGTCCACCTAAACCGGAGGCGGTTATAGATGCTATAACAAAACTTCGTAAAAAAATATCTCGAGA AATTTATGAAGATCGAATTAGGTCTCAACCGGGGAATCGGTGTTTTACTACCAATCACAAGTTTAATATTGAACGCACTA CTCATACTGGAAATTATGATCGAGGATTACTCTATCAACCGCCGTCTACTTCAAAGATCCCTCCTGAAACATTTTTCAAA TATAAAAGGTCAGTATCGTCCCACGAATTAGTAAATTA
Gene structure

JCDB Genes gff download

JCDBG00042 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00042's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00042JCDBG00100co-exp0.91609
JCDBG00042JCDBG00067co-exp0.900122
JCDBG00042JCDBG00047co-exp0.899261
JCDBG00042JCDBG00015co-exp0.895991
JCDBG00042JCDBG00014co-exp0.895739
JCDBG00042JCDBG00072co-exp0.888954
JCDBG00042JCDBG00076co-exp0.878569
JCDBG00042JCDBG00073co-exp0.877775
JCDBG00042JCDBG00016co-exp0.87673
JCDBG00042JCDBG00071co-exp0.860909
JCDBG00100JCDBG00067co-exp0.81633
JCDBG00100JCDBG00047co-exp0.821621
JCDBG00100JCDBG00015co-exp0.823086
JCDBG00100JCDBG00014co-exp0.790546
JCDBG00100JCDBG00072co-exp0.887318
JCDBG00100JCDBG00076co-exp0.852873
JCDBG00100JCDBG00073co-exp0.863882
JCDBG00100JCDBG00016co-exp0.848717
JCDBG00100JCDBG00071co-exp0.775348
JCDBG00067JCDBG00047co-exp0.923353
JCDBG00067JCDBG00015co-exp0.793527
JCDBG00067JCDBG00014co-exp0.798582
JCDBG00067JCDBG00072co-exp0.876583
JCDBG00067JCDBG00076co-exp0.739997
JCDBG00067JCDBG00073co-exp0.715937
JCDBG00067JCDBG00016co-exp0.758045
JCDBG00067JCDBG00071co-exp0.921919
JCDBG00047JCDBG00015co-exp0.758093
JCDBG00047JCDBG00014co-exp0.747643
JCDBG00047JCDBG00072co-exp0.861011
JCDBG00047JCDBG00076co-exp0.714558
JCDBG00047JCDBG00073co-exp0.698535
JCDBG00047JCDBG00016co-exp0.761544
JCDBG00047JCDBG00071co-exp0.937953
JCDBG00015JCDBG00014co-exp0.962428
JCDBG00015JCDBG00072co-exp0.750358
JCDBG00015JCDBG00076co-exp0.930852
JCDBG00015JCDBG00073co-exp0.832888
JCDBG00015JCDBG00016co-exp0.940419
JCDBG00015JCDBG00071co-exp0.745229
JCDBG00014JCDBG00072co-exp0.717311
JCDBG00014JCDBG00076co-exp0.927644
JCDBG00014JCDBG00073co-exp0.847308
JCDBG00014JCDBG00016co-exp0.880861
JCDBG00014JCDBG00071co-exp0.728273
JCDBG00072JCDBG00076co-exp0.727517
JCDBG00072JCDBG00073co-exp0.777219
JCDBG00072JCDBG00016co-exp0.783128
JCDBG00072JCDBG00071co-exp0.850068
JCDBG00076JCDBG00073co-exp0.907254
JCDBG00076JCDBG00016co-exp0.885852
JCDBG00076JCDBG00071co-exp0.679084
JCDBG00073JCDBG00016co-exp0.842042
JCDBG00073JCDBG00071co-exp0.641366
JCDBG00016JCDBG00071co-exp0.74714
PPI network
node1node2type
JCDBR00042
ID
JCDBR00042
Name
ndhK
Type
protein_coding
Scaffold
NC_012224.1
Start
54312
End
54989
Strand
-
Exon
54312-54989
Sequence
TATGAATTCCATTGAGTTTCCTTTACTTGATCAAACAACTAAAATTTCAGTTATTTCAACTACATCAAATGATCTTTCAA ATTGGTCAAGACTCTCCAGTTTATGGCCACTTCTCTATGGTACCAGTTGTTGCTTCATTGAATTTGCTTCGTTAATAGGC TCACGATTCGACTTTGATCGTTATGGACTAGTACCAAGATCTAGTCCTAGACAAGCGGACCTGATTTTAACAGCCGGCAC AGTAACCATGAAAATGGCTCCCTCTTTAGTGAGATTATATGAACAAATGCCAGAACCAAAATATGTTATTGCTATGGGGG CATGTACAATTACAGGGGGGATGTTCAGTACCGATTCTTATAGTACTGTTCGGGGAGTCGATAAGCTAATTCCTGTAGAT GTCTATTTGCCAGGCTGTCCACCTAAACCGGAGGCGGTTATAGATGCTATAACAAAACTTCGTAAAAAAATATCTCGAGA AATTTATGAAGATCGAATTAGGTCTCAACCGGGGAATCGGTGTTTTACTACCAATCACAAGTTTAATATTGAACGCACTA CTCATACTGGAAATTATGATCGAGGATTACTCTATCAACCGCCGTCTACTTCAAAGATCCCTCCTGAAACATTTTTCAAA TATAAAAGGTCAGTATCGTCCCACGAATTAGTAAATTA
Product
Source
RefSeq
Link:
JCDBP00024
ID
JCDBP00024
Parent
JCDBR00042
Name
YP_002720116.1
Scaffold
NC_012224.1
CDS
54312-54989
Strand:
-
Sequence
MNSIEFPLLDQTTKISVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFASLIGSRFDFDRYGLVPRSSPRQADLILTAGT VTMKMAPSLVRLYEQMPEPKYVIAMGACTITGGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDAITKLRKKISRE IYEDRIRSQPGNRCFTTNHKFNIERTTHTGNYDRGLLYQPPSTSKIPPETFFKYKRSVSSHELVN
Product
NADH dehydrogenase subunit K
Source
RefSeq
Link
YP_002720116.1
InterProScan
IPR006137 NADH:ubiquinone oxidoreductase-like, 20kDa subunit
IPR006138 NADH-ubiquinone oxidoreductase, 20 Kd subunit
Pfam
PF01058.18 Oxidored_q6 Family