Detail information of JCDBG00043

JCDBG00043
ID
JCDBG00043
Name
ndhC
Type
protein_coding
Scaffold
NC_012224.1
Start
55043
End
55405
Strand
-
Link
Genbank id:7564865
Molecular function
GO:0016651 | oxidoreductase activity, acting on NAD(P)H
GO:0008137 | NADH dehydrogenase (ubiquinone) activity
Cellular component
Biological process
GO:0055114 | oxidation-reduction process
KEGG
Entry: K05574
Name: ndhC
Definition: NAD(P)H-quinone oxidoreductase subunit 3 [EC:1.6.5.3]
ko00190:   Oxidative phosphorylation
Source
RefSeq
TF
Description
Sequence
TATGTTTCTGATTTACGAATATGATATATTCTGGGCATTTCTAATAATATCAAGTGCTATTCCTATTTTAGCATTTCTAA TTTCCGGAGTTTTATCCCCGATTAGCAAAGGGCCGGAGAAACTTTCTAGTTATGAATCGGGTATAGAACCAATGGGCGAT GCTTGGTTACAATTTCGAATCCGTTACTATATGTTTGCTCTAGTTTTTGTTGTTTTTGATGTTGAAACCGTTTTTCTTTA TCCATGGGCAATGAGTTTCGATATATTGGGGTTATCCGCATTTATAGAAGCTTTAATTTTCGTACTTATCCTAATTGTTG GTTTAGTTTATGCGTGGAGAAAAGGAGCGTTAGAATGGTCTTA
Gene structure

JCDB Genes gff download

JCDBG00043 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00043's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00043JCDBG00013co-exp0.958265
JCDBG00043JCDBG00029co-exp0.950823
JCDBG00043JCDBG00064co-exp0.912455
JCDBG00043JCDBG00020co-exp0.888094
JCDBG00043JCDBG00014co-exp0.885746
JCDBG00043JCDBG00015co-exp0.838211
JCDBG00043JCDBG00103co-exp0.825906
JCDBG00043JCDBG00066co-exp0.801506
JCDBG00043JCDBG10097co-exp0.801265
JCDBG00043JCDBG17813co-exp-0.795074
JCDBG00013JCDBG00029co-exp0.954387
JCDBG00013JCDBG00064co-exp0.907456
JCDBG00013JCDBG00020co-exp0.882966
JCDBG00013JCDBG00014co-exp0.863631
JCDBG00013JCDBG00015co-exp0.801903
JCDBG00013JCDBG00103co-exp0.758222
JCDBG00013JCDBG00066co-exp0.788828
JCDBG00013JCDBG10097co-exp0.796858
JCDBG00013JCDBG17813co-exp-0.816654
JCDBG00029JCDBG00064co-exp0.87883
JCDBG00029JCDBG00020co-exp0.868454
JCDBG00029JCDBG00014co-exp0.879308
JCDBG00029JCDBG00015co-exp0.810684
JCDBG00029JCDBG00103co-exp0.772204
JCDBG00029JCDBG00066co-exp0.741453
JCDBG00029JCDBG10097co-exp0.790134
JCDBG00029JCDBG17813co-exp-0.787629
JCDBG00064JCDBG00020co-exp0.899486
JCDBG00064JCDBG00014co-exp0.756636
JCDBG00064JCDBG00015co-exp0.698302
JCDBG00064JCDBG00103co-exp0.789889
JCDBG00064JCDBG00066co-exp0.767701
JCDBG00064JCDBG10097co-exp0.752264
JCDBG00064JCDBG17813co-exp-0.814532
JCDBG00020JCDBG00014co-exp0.710887
JCDBG00020JCDBG00015co-exp0.679902
JCDBG00020JCDBG00103co-exp0.756766
JCDBG00020JCDBG00066co-exp0.64672
JCDBG00020JCDBG10097co-exp0.797362
JCDBG00020JCDBG17813co-exp-0.793444
JCDBG00014JCDBG00015co-exp0.962428
JCDBG00014JCDBG00103co-exp0.803491
JCDBG00014JCDBG00066co-exp0.856988
JCDBG00014JCDBG10097co-exp0.679682
JCDBG00014JCDBG17813co-exp-0.644969
JCDBG00015JCDBG00103co-exp0.826044
JCDBG00015JCDBG00066co-exp0.817076
JCDBG00015JCDBG10097co-exp0.645351
JCDBG00103JCDBG00066co-exp0.80025
JCDBG00103JCDBG10097co-exp0.654721
JCDBG00103JCDBG17813co-exp-0.605758
JCDBG10097JCDBG17813co-exp-0.822646
PPI network
node1node2type
JCDBR00043
ID
JCDBR00043
Name
ndhC
Type
protein_coding
Scaffold
NC_012224.1
Start
55043
End
55405
Strand
-
Exon
55043-55405
Sequence
TATGTTTCTGATTTACGAATATGATATATTCTGGGCATTTCTAATAATATCAAGTGCTATTCCTATTTTAGCATTTCTAA TTTCCGGAGTTTTATCCCCGATTAGCAAAGGGCCGGAGAAACTTTCTAGTTATGAATCGGGTATAGAACCAATGGGCGAT GCTTGGTTACAATTTCGAATCCGTTACTATATGTTTGCTCTAGTTTTTGTTGTTTTTGATGTTGAAACCGTTTTTCTTTA TCCATGGGCAATGAGTTTCGATATATTGGGGTTATCCGCATTTATAGAAGCTTTAATTTTCGTACTTATCCTAATTGTTG GTTTAGTTTATGCGTGGAGAAAAGGAGCGTTAGAATGGTCTTA
Product
Source
RefSeq
Link:
JCDBP00025
ID
JCDBP00025
Parent
JCDBR00043
Name
YP_002720117.1
Scaffold
NC_012224.1
CDS
55043-55405
Strand:
-
Sequence
MFLIYEYDIFWAFLIISSAIPILAFLISGVLSPISKGPEKLSSYESGIEPMGDAWLQFRIRYYMFALVFVVFDVETVFLY PWAMSFDILGLSAFIEALIFVLILIVGLVYAWRKGALEWS
Product
NADH dehydrogenase subunit 3
Source
RefSeq
Link
YP_002720117.1
InterProScan
IPR000440 NADH:ubiquinone/plastoquinone oxidoreductase, chain 3
IPR023043 NAD(P)H-quinone oxidoreductase subunit 3, bacterial/plastid
Pfam
PF00507.15 Oxidored_q4 Family