Detail information of JCDBG00046

JCDBG00046
ID
JCDBG00046
Name
atpE
Type
protein_coding
Scaffold
NC_012224.1
Start
57561
End
57962
Strand
-
Link
Genbank id:7564868
Molecular function
GO:0046961 | proton-transporting ATPase activity, rotational mechanism
GO:0046933 | proton-transporting ATP synthase activity, rotational mechanism
Cellular component
GO:0045261 | proton-transporting ATP synthase complex, catalytic core F(1)
Biological process
GO:0015986 | ATP synthesis coupled proton transport
KEGG
Entry: K02114
Name: ATPF1E, atpC
Definition: F-type H+-transporting ATPase subunit epsilon
ko00190:   Oxidative phosphorylation
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
AATGACCTTAAATCTTTGTGTACTGACCCCAAATCGAATTGTTTGGGATTCAGAAGTGAAAGAAATCATTTTATCTACTA ATAGTGGGCAAATTGGCGTATTACCAAATCATGCGCCTATTGCCACAGCTGTCGATATCGGTATTTTGAGAATACGCCTT AATGCCAAATGGTTAACGATGGCTCTGATGGGTGGTTTTGCTAGAATAGGCAATAATGAGATTACTGTTTTAGTAAATGA TGCAGAGAAGGGTAGTGACATTGATCCACAAGAAGCTCAGCAAACTCTTGAAATAGCAGAAGCTAACTTGAGAAAAGCGG AAGGAAAGAGACAAATAATTGAGGCAAATCTAGCTCTCAGACGAGCTAGGGCACGAGTAGAGGCTATCAATGTGATTTCG TA
Gene structure

JCDB Genes gff download

JCDBG00046 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00046's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00046JCDBG00037co-exp0.956923
JCDBG00046JCDBG00065co-exp0.954196
JCDBG00046JCDBG00012co-exp0.949104
JCDBG00046JCDBG00032co-exp0.945749
JCDBG00046JCDBG07355co-exp0.936736
JCDBG00046JCDBG00063co-exp0.932346
JCDBG00046JCDBG00112co-exp0.924872
JCDBG00046JCDBG00070co-exp0.918786
JCDBG00046JCDBG00062co-exp0.908979
JCDBG00046JCDBG11239co-exp0.899265
JCDBG00037JCDBG00065co-exp0.962165
JCDBG00037JCDBG00012co-exp0.963833
JCDBG00037JCDBG00032co-exp0.917854
JCDBG00037JCDBG07355co-exp0.930475
JCDBG00037JCDBG00063co-exp0.966339
JCDBG00037JCDBG00112co-exp0.958141
JCDBG00037JCDBG00070co-exp0.943138
JCDBG00037JCDBG00062co-exp0.934869
JCDBG00037JCDBG11239co-exp0.943379
JCDBG00065JCDBG00012co-exp0.946607
JCDBG00065JCDBG00032co-exp0.899738
JCDBG00065JCDBG07355co-exp0.934898
JCDBG00065JCDBG00063co-exp0.942622
JCDBG00065JCDBG00112co-exp0.944148
JCDBG00065JCDBG00070co-exp0.908277
JCDBG00065JCDBG00062co-exp0.946062
JCDBG00065JCDBG11239co-exp0.91345
JCDBG00012JCDBG00032co-exp0.935341
JCDBG00012JCDBG07355co-exp0.91033
JCDBG00012JCDBG00063co-exp0.938615
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG00070co-exp0.911621
JCDBG00012JCDBG00062co-exp0.910668
JCDBG00012JCDBG11239co-exp0.912939
JCDBG00032JCDBG07355co-exp0.933694
JCDBG00032JCDBG00063co-exp0.894993
JCDBG00032JCDBG00112co-exp0.894441
JCDBG00032JCDBG00070co-exp0.913395
JCDBG00032JCDBG00062co-exp0.87634
JCDBG00032JCDBG11239co-exp0.833857
JCDBG07355JCDBG00063co-exp0.927425
JCDBG07355JCDBG00112co-exp0.887364
JCDBG07355JCDBG00070co-exp0.909479
JCDBG07355JCDBG00062co-exp0.891163
JCDBG07355JCDBG11239co-exp0.874631
JCDBG00063JCDBG00112co-exp0.929563
JCDBG00063JCDBG00070co-exp0.952478
JCDBG00063JCDBG00062co-exp0.914786
JCDBG00063JCDBG11239co-exp0.950032
JCDBG00112JCDBG00070co-exp0.886046
JCDBG00112JCDBG00062co-exp0.902815
JCDBG00112JCDBG11239co-exp0.919971
JCDBG00070JCDBG00062co-exp0.90613
JCDBG00070JCDBG11239co-exp0.898642
JCDBG00062JCDBG11239co-exp0.888295
PPI network
node1node2type
JCDBG00046JCDBG07173PPI
JCDBR00046
ID
JCDBR00046
Name
atpE
Type
protein_coding
Scaffold
NC_012224.1
Start
57561
End
57962
Strand
-
Exon
57561-57962
Sequence
AATGACCTTAAATCTTTGTGTACTGACCCCAAATCGAATTGTTTGGGATTCAGAAGTGAAAGAAATCATTTTATCTACTA ATAGTGGGCAAATTGGCGTATTACCAAATCATGCGCCTATTGCCACAGCTGTCGATATCGGTATTTTGAGAATACGCCTT AATGCCAAATGGTTAACGATGGCTCTGATGGGTGGTTTTGCTAGAATAGGCAATAATGAGATTACTGTTTTAGTAAATGA TGCAGAGAAGGGTAGTGACATTGATCCACAAGAAGCTCAGCAAACTCTTGAAATAGCAGAAGCTAACTTGAGAAAAGCGG AAGGAAAGAGACAAATAATTGAGGCAAATCTAGCTCTCAGACGAGCTAGGGCACGAGTAGAGGCTATCAATGTGATTTCG TA
Product
Source
RefSeq
Link:
JCDBP00026
ID
JCDBP00026
Parent
JCDBR00046
Name
YP_002720118.1
Scaffold
NC_012224.1
CDS
57561-57962
Strand:
-
Sequence
MTLNLCVLTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLNAKWLTMALMGGFARIGNNEITVLVND AEKGSDIDPQEAQQTLEIAEANLRKAEGKRQIIEANLALRRARARVEAINVIS
Product
atpE
Source
RefSeq
Link
YP_002720118.1
InterProScan
IPR001469 ATPase, F1 complex, delta/epsilon subunit
IPR020546 ATPase, F1 complex, delta/epsilon subunit, N-terminal
IPR020547 ATP synthase delta/epsilon subunit, C-terminal domain
Pfam
PF02823.12 ATP-synt_DE_N Domain
PF00401.16 ATP-synt_DE Domain