Detail information of JCDBG00047

JCDBG00047
ID
JCDBG00047
Name
atpB
Type
protein_coding
Scaffold
NC_012224.1
Start
57959
End
59446
Strand
-
Link
Genbank id:7564869
Molecular function
GO:0005524 | ATP binding
GO:0016820 | hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
GO:0046933 | proton-transporting ATP synthase activity, rotational mechanism
Cellular component
GO:0033178 | proton-transporting two-sector ATPase complex, catalytic domain
Biological process
GO:0046034 | ATP metabolic process
GO:0015986 | ATP synthesis coupled proton transport
GO:0015991 | ATP hydrolysis coupled proton transport
GO:0015992 | proton transport
KEGG
Entry: K02112
Name: ATPF1B, atpD
Definition: F-type H+-transporting ATPase subunit beta [EC:3.6.3.14]
ko00190:   Oxidative phosphorylation
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TATGAGAATCAATCCTACTACTTCTGGTCCGGGAGTTCCCGCGCTTGAAAAAAAGAACCTGGGGCGTATCGCTCAAATCA TTGGGCCAGTACTAGATGTAGCTTTTTCCCCGGGCAAGATGCCTAATATTTACAACGCTCTGGTAGTTAAGGGTCGAGAT ACTGTCGGGCAAGAAATTAATGTGACTTGTGAAGTACAACAATTATTAGGAAATAATCGAGTTCGGGCTGTAGCTATGAG TGCTACAGATGGTCTAACGCGAGGAATGGAAGTGATTGACACAGGAGCTCCTCTAAGTGTTCCAGTTGGTGGGGCGACTC TAGGACGAATTTTCAACGTGCTTGGAGAACCTGTTGATGATTTAGGTCCTGTAGATACTCGCGCAACATCACCTATTCAT AGATCTGCACCTGCTTTTATACAATTAGATACAAAATTATCTATTTTTGAAACAGGAATTAAAGTAGTAGATCTTTTAGC CCCTTATCGCCGTGGAGGAAAAATCGGACTATTCGGGGGAGCTGGAGTGGGTAAAACAGTACTTATTATGGAATTAATCA ACAACATCGCGAAAGCTCATGGAGGCGTATCCGTATTTGGCGGAGTAGGCGAACGAACTCGTGAAGGAAATGATCTTTAC ATGGAAATGAAAGAATCTGGAGTAATTAATCAAGAAAATATTGCAGAATCAAAAGTGGCTCTAGTCTATGGTCAGATGAA CGAACCGCCGGGAGCTCGTATGAGAGTTGGTTTGACTGCCCTAACTATGGCGGAATATTTCCGAGATGTTAATGAACAAG ACGTACTTCTATTTATCGACAATATCTTCCGTTTCGTCCAAGCAGGATCCGAAGTATCCGCCTTATTGGGTAGAATGCCT TCTGCTGTGGGTTATCAACCTACCCTTAGTACCGAAATGGGTTCTTTACAAGAAAGAATTACTTCCACCAAAGAGGGGTC CATAACTTCTATTCAAGCAGTTTATGTACCTGCGGACGATTTGACTGACCCTGCTCCTGCCACGACATTTGCACATTTAG ATGCGACTACTGTACTATCAAGAGGATTAGCTGCTAAAGGTATCTATCCAGCAGTAGATCCTTTAGATTCAACATCAACT ATGCTCCAACCTCAGATCGTTGGTGAGGAACATTATGAAACTGCGCAAAGAGTTAAGCAAACTTTACAACGTTACAAAGA ACTTCAGGACATTATAGCTATCCTTGGGCTGGACGAATTATCCGAAGAGGATCGTTTAACTGTAGCAAGAGCACGAAAAA TTGAGCGTTTCTTATCACAACCCTTTTTCGTAGCAGAAGTATTTACCGGTTCTCCGGGTAAATATGTCGGTCTAGCAGAA ACTATTAGAGGGTTTAAATTGATCCTTTCCGGAGAATTAGATAGTCTCCCTGAACAGGCCTTTTATTTGGTAGGTAATAT TGATGAAGCTACTGCGAAGGCTACAAACTTAGAAATGGAGAACAAATG
Gene structure

JCDB Genes gff download

JCDBG00047 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00047's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00047JCDBG00071co-exp0.937953
JCDBG00047JCDBG00067co-exp0.923353
JCDBG00047JCDBG00026co-exp0.916383
JCDBG00047JCDBG00027co-exp0.913089
JCDBG00047JCDBG00042co-exp0.899261
JCDBG00047JCDBG00033co-exp0.885043
JCDBG00047JCDBG00002co-exp0.867959
JCDBG00047JCDBG00072co-exp0.861011
JCDBG00047JCDBG00004co-exp0.839702
JCDBG00047JCDBG00034co-exp0.836956
JCDBG00071JCDBG00067co-exp0.921919
JCDBG00071JCDBG00026co-exp0.934561
JCDBG00071JCDBG00027co-exp0.925427
JCDBG00071JCDBG00042co-exp0.860909
JCDBG00071JCDBG00033co-exp0.899852
JCDBG00071JCDBG00002co-exp0.893332
JCDBG00071JCDBG00072co-exp0.850068
JCDBG00071JCDBG00004co-exp0.805613
JCDBG00071JCDBG00034co-exp0.815403
JCDBG00067JCDBG00026co-exp0.902249
JCDBG00067JCDBG00027co-exp0.928913
JCDBG00067JCDBG00042co-exp0.900122
JCDBG00067JCDBG00033co-exp0.87946
JCDBG00067JCDBG00002co-exp0.859833
JCDBG00067JCDBG00072co-exp0.876583
JCDBG00067JCDBG00004co-exp0.759114
JCDBG00067JCDBG00034co-exp0.84116
JCDBG00026JCDBG00027co-exp0.967986
JCDBG00026JCDBG00042co-exp0.811813
JCDBG00026JCDBG00033co-exp0.950075
JCDBG00026JCDBG00002co-exp0.926188
JCDBG00026JCDBG00072co-exp0.818663
JCDBG00026JCDBG00004co-exp0.772613
JCDBG00026JCDBG00034co-exp0.863772
JCDBG00027JCDBG00042co-exp0.810646
JCDBG00027JCDBG00033co-exp0.935167
JCDBG00027JCDBG00002co-exp0.921385
JCDBG00027JCDBG00072co-exp0.834429
JCDBG00027JCDBG00004co-exp0.737985
JCDBG00027JCDBG00034co-exp0.884364
JCDBG00042JCDBG00033co-exp0.779329
JCDBG00042JCDBG00002co-exp0.746694
JCDBG00042JCDBG00072co-exp0.888954
JCDBG00042JCDBG00004co-exp0.814407
JCDBG00042JCDBG00034co-exp0.778555
JCDBG00033JCDBG00002co-exp0.899406
JCDBG00033JCDBG00072co-exp0.825452
JCDBG00033JCDBG00004co-exp0.750123
JCDBG00033JCDBG00034co-exp0.902027
JCDBG00002JCDBG00072co-exp0.717616
JCDBG00002JCDBG00004co-exp0.716885
JCDBG00002JCDBG00034co-exp0.816051
JCDBG00072JCDBG00004co-exp0.826225
JCDBG00072JCDBG00034co-exp0.849769
JCDBG00004JCDBG00034co-exp0.718795
PPI network
node1node2type
JCDBG00047JCDBG09643PPI
JCDBG00047JCDBG21503PPI
JCDBG00047JCDBG21117PPI
JCDBG00047JCDBG06390PPI
JCDBG00047JCDBG03124PPI
JCDBG00047JCDBG22854PPI
JCDBG00047JCDBG16806PPI
JCDBG00047JCDBG00973PPI
JCDBG00047JCDBG15596PPI
JCDBG00047JCDBG05196PPI
JCDBG00047JCDBG11784PPI
JCDBG00047JCDBG09736PPI
JCDBG00047JCDBG24392PPI
JCDBG00047JCDBG15171PPI
JCDBG00047JCDBG24246PPI
JCDBG21503JCDBG21117PPI
JCDBG21503JCDBG06390PPI
JCDBG21503JCDBG16806PPI
JCDBG21503JCDBG11784PPI
JCDBG21503JCDBG24392PPI
JCDBG21117JCDBG11784PPI
JCDBG21117JCDBG24392PPI
JCDBG06390JCDBG16806PPI
JCDBG06390JCDBG11784PPI
JCDBG06390JCDBG24392PPI
JCDBG03124JCDBG05196PPI
JCDBG16806JCDBG11784PPI
JCDBG16806JCDBG24392PPI
JCDBG00973JCDBG24246PPI
JCDBG11784JCDBG24392PPI
JCDBR00047
ID
JCDBR00047
Name
atpB
Type
protein_coding
Scaffold
NC_012224.1
Start
57959
End
59446
Strand
-
Exon
57959-59446
Sequence
TATGAGAATCAATCCTACTACTTCTGGTCCGGGAGTTCCCGCGCTTGAAAAAAAGAACCTGGGGCGTATCGCTCAAATCA TTGGGCCAGTACTAGATGTAGCTTTTTCCCCGGGCAAGATGCCTAATATTTACAACGCTCTGGTAGTTAAGGGTCGAGAT ACTGTCGGGCAAGAAATTAATGTGACTTGTGAAGTACAACAATTATTAGGAAATAATCGAGTTCGGGCTGTAGCTATGAG TGCTACAGATGGTCTAACGCGAGGAATGGAAGTGATTGACACAGGAGCTCCTCTAAGTGTTCCAGTTGGTGGGGCGACTC TAGGACGAATTTTCAACGTGCTTGGAGAACCTGTTGATGATTTAGGTCCTGTAGATACTCGCGCAACATCACCTATTCAT AGATCTGCACCTGCTTTTATACAATTAGATACAAAATTATCTATTTTTGAAACAGGAATTAAAGTAGTAGATCTTTTAGC CCCTTATCGCCGTGGAGGAAAAATCGGACTATTCGGGGGAGCTGGAGTGGGTAAAACAGTACTTATTATGGAATTAATCA ACAACATCGCGAAAGCTCATGGAGGCGTATCCGTATTTGGCGGAGTAGGCGAACGAACTCGTGAAGGAAATGATCTTTAC ATGGAAATGAAAGAATCTGGAGTAATTAATCAAGAAAATATTGCAGAATCAAAAGTGGCTCTAGTCTATGGTCAGATGAA CGAACCGCCGGGAGCTCGTATGAGAGTTGGTTTGACTGCCCTAACTATGGCGGAATATTTCCGAGATGTTAATGAACAAG ACGTACTTCTATTTATCGACAATATCTTCCGTTTCGTCCAAGCAGGATCCGAAGTATCCGCCTTATTGGGTAGAATGCCT TCTGCTGTGGGTTATCAACCTACCCTTAGTACCGAAATGGGTTCTTTACAAGAAAGAATTACTTCCACCAAAGAGGGGTC CATAACTTCTATTCAAGCAGTTTATGTACCTGCGGACGATTTGACTGACCCTGCTCCTGCCACGACATTTGCACATTTAG ATGCGACTACTGTACTATCAAGAGGATTAGCTGCTAAAGGTATCTATCCAGCAGTAGATCCTTTAGATTCAACATCAACT ATGCTCCAACCTCAGATCGTTGGTGAGGAACATTATGAAACTGCGCAAAGAGTTAAGCAAACTTTACAACGTTACAAAGA ACTTCAGGACATTATAGCTATCCTTGGGCTGGACGAATTATCCGAAGAGGATCGTTTAACTGTAGCAAGAGCACGAAAAA TTGAGCGTTTCTTATCACAACCCTTTTTCGTAGCAGAAGTATTTACCGGTTCTCCGGGTAAATATGTCGGTCTAGCAGAA ACTATTAGAGGGTTTAAATTGATCCTTTCCGGAGAATTAGATAGTCTCCCTGAACAGGCCTTTTATTTGGTAGGTAATAT TGATGAAGCTACTGCGAAGGCTACAAACTTAGAAATGGAGAACAAATG
Product
Source
RefSeq
Link:
JCDBP00027
ID
JCDBP00027
Parent
JCDBR00047
Name
YP_002720119.1
Scaffold
NC_012224.1
CDS
57959-59446
Strand:
-
Sequence
MRINPTTSGPGVPALEKKNLGRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTVGQEINVTCEVQQLLGNNRVRAVAMS ATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDDLGPVDTRATSPIHRSAPAFIQLDTKLSIFETGIKVVDLLA PYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINQENIAESKVALVYGQMN EPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGS ITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPQIVGEEHYETAQRVKQTLQRYKE LQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDSLPEQAFYLVGNI DEATAKATNLEMENK
Product
ATP synthase CF1 beta subunit
Source
RefSeq
Link
YP_002720119.1
InterProScan
IPR000194 ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain
IPR000793 ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal
IPR003593 AAA+ ATPase domain
IPR004100 ATPase, F1 complex alpha/beta subunit, N-terminal domain
IPR005722 ATPase, F1 complex, beta subunit
IPR020003 ATPase, alpha/beta subunit, nucleotide-binding domain, active site
IPR024034 ATPase, F1 complex beta subunit/V1 complex, C-terminal
IPR027417 P-loop containing nucleoside triphosphate hydrolase
Pfam
PF02874.19 ATP-synt_ab_N Domain
PF00006.21 ATP-synt_ab Family
PF00306.23 ATP-synt_ab_C Domain