Detail information of JCDBG00048

JCDBG00048
ID
JCDBG00048
Name
rbcL
Type
protein_coding
Scaffold
NC_012224.1
Start
60251
End
61678
Strand
+
Link
Genbank id:7564870 | Jatropha Genome Database ID:Jcr4S09385.10
Molecular function
GO:0000287 | magnesium ion binding
GO:0016984 | ribulose-bisphosphate carboxylase activity
Cellular component
Biological process
GO:0015977 | carbon fixation
KEGG
Entry: K01601
Name: rbcL
Definition: ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
ko00630:   Glyoxylate and dicarboxylate metabolism
ko00710:   Carbon fixation in photosynthetic organisms
ko01200:   Carbon metabolism
Source
RefSeq
TF
Description
Sequence
TGTCACCACAAACAGAGACTAAAGCAAGTGTTGGATTCAAGGCTGGTGTTAAAGATTATAAATTGACTTATTATACTCCT GAGTATCAAACCAAAGATACTGATATCTTGGCAGCATTCCGAGTAACTCCTCAACCTGGAGTTCCGCCTGAGGAAGCAGG AGCTGCGGTAGCTGCTGAATCTTCTACTGGTACATGGACAACTGTGTGGACCGATGGGCTTACCAGTCTTGATCGTTATA AAGGACGATGCTACGACATCGAGCCCGTTGCTGGAGAAGAAAATCAATATATTGCTTATGTAGCTTACCCCTTAGACCTT TTTGAAGAAGGTTCTGTTACTAACATGTTTACTTCCATTGTGGGTAATGTATTTGGGTTCAAAGCCCTACGCGCCCTACG TCTGGAGGATTTGCGAATCCCTACTGCTTATACTAAAACTTTCCAAGGGCCGCCTCATGGTATCCAAGTTGAGAGAGATA AATTGAACAAGTATGGTCGCCCCCTATTGGGTTGTACTATTAAACCTAAATTGGGGCTATCCGCTAAGAATTATGGTAGA GCGGTTTATGAATGTCTTCGCGGTGGACTTGATTTTACCAAAGATGATGAGAACGTGAATTCCCAACCATTTATGCGTTG GAGAGACCGTTTCTTATTTTGTGCCGAAGCAATTTATAAAGCACAGGCTGAAACAGGTGAAATCAAAGGACATTATTTGA ATGCTACTGCAGGTACATGTGAAGAAATGATCAAAAGGGCTGTATTTGCCAGAGAATTAGGAGTTCCTATCGTAATGCAT GACTACCTAACAGGGGGATTCACCGCAAATACTTCCTTGGCTCATTATTGCCGTGATAATGGTTTACTTCTTCACATTCA CCGCGCAATGCATGCAGTTATTGATAGACAGAAGAATCATGGTATGCATTTTCGTGTACTAGCTAAGGCGTTACGTTTGT CTGGTGGAGATCATATTCACGCTGGTACCGTAGTAGGTAAACTTGAAGGGGAAAGAGACATCACTTTGGGCTTTGTTGAT TTACTGCGTGATGATTTTATTGAAAAAGATCGAAGCCGCGGTATTTATTTCACTCAAGATTGGGTCTCTCTACCGGGTGT TTTGCCTGTAGCTTCAGGAGGTATTCACGTTTGGCATATGCCTGCTCTGACCGAGATCTTTGGAGATGATTCCGTACTAC AATTCGGTGGAGGAACTTTAGGGCACCCTTGGGGAAATGCACCTGGTGCCGTAGCTAATCGAGTAGCTCTAGAAGCATGT GTACAAGCTCGTAATGAAGGACGTGATCTTGCTCGTGAGGGTAATGAAATTATCCGTGAGGCTAGCAAATGGAGTCCTGA ACTAGCTGCTGCTTGTGAAGTATGGAAGGAGATTAAATTTGAATTCCAAGCGATGGATACTTTGTAAT
Gene structure

JCDB Genes gff download

JCDBG00048 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00048's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00048JCDBG00002co-exp0.845832
JCDBG00048JCDBG00026co-exp0.835686
JCDBG00048JCDBG00027co-exp0.818448
JCDBG00048JCDBG00033co-exp0.814849
JCDBG00048JCDBG05723co-exp0.81412
JCDBG00048JCDBG00071co-exp0.8096
JCDBG00048JCDBG23281co-exp0.809504
JCDBG00048JCDBG13367co-exp0.799287
JCDBG00048JCDBG04222co-exp0.798292
JCDBG00048JCDBG03794co-exp0.791385
JCDBG00002JCDBG00026co-exp0.926188
JCDBG00002JCDBG00027co-exp0.921385
JCDBG00002JCDBG00033co-exp0.899406
JCDBG00002JCDBG05723co-exp0.728555
JCDBG00002JCDBG00071co-exp0.893332
JCDBG00002JCDBG23281co-exp0.674441
JCDBG00002JCDBG13367co-exp0.677167
JCDBG00002JCDBG04222co-exp0.772758
JCDBG00002JCDBG03794co-exp0.807003
JCDBG00026JCDBG00027co-exp0.967986
JCDBG00026JCDBG00033co-exp0.950075
JCDBG00026JCDBG05723co-exp0.716901
JCDBG00026JCDBG00071co-exp0.934561
JCDBG00026JCDBG23281co-exp0.678284
JCDBG00026JCDBG13367co-exp0.622782
JCDBG00026JCDBG04222co-exp0.738581
JCDBG00026JCDBG03794co-exp0.798847
JCDBG00027JCDBG00033co-exp0.935167
JCDBG00027JCDBG05723co-exp0.726291
JCDBG00027JCDBG00071co-exp0.925427
JCDBG00027JCDBG23281co-exp0.681114
JCDBG00027JCDBG13367co-exp0.627094
JCDBG00027JCDBG04222co-exp0.769405
JCDBG00027JCDBG03794co-exp0.830709
JCDBG00033JCDBG05723co-exp0.757636
JCDBG00033JCDBG00071co-exp0.899852
JCDBG00033JCDBG23281co-exp0.712854
JCDBG00033JCDBG13367co-exp0.641491
JCDBG00033JCDBG04222co-exp0.77315
JCDBG00033JCDBG03794co-exp0.856116
JCDBG05723JCDBG00071co-exp0.666861
JCDBG05723JCDBG23281co-exp0.883344
JCDBG05723JCDBG13367co-exp0.892226
JCDBG05723JCDBG04222co-exp0.865076
JCDBG05723JCDBG03794co-exp0.889506
JCDBG00071JCDBG23281co-exp0.614249
JCDBG00071JCDBG04222co-exp0.712001
JCDBG00071JCDBG03794co-exp0.743885
JCDBG23281JCDBG13367co-exp0.871894
JCDBG23281JCDBG04222co-exp0.781746
JCDBG23281JCDBG03794co-exp0.832707
JCDBG13367JCDBG04222co-exp0.777218
JCDBG13367JCDBG03794co-exp0.808857
JCDBG04222JCDBG03794co-exp0.851075
PPI network
node1node2type
JCDBR00048
ID
JCDBR00048
Name
rbcL
Type
protein_coding
Scaffold
NC_012224.1
Start
60251
End
61678
Strand
+
Exon
60251-61678
Sequence
TGTCACCACAAACAGAGACTAAAGCAAGTGTTGGATTCAAGGCTGGTGTTAAAGATTATAAATTGACTTATTATACTCCT GAGTATCAAACCAAAGATACTGATATCTTGGCAGCATTCCGAGTAACTCCTCAACCTGGAGTTCCGCCTGAGGAAGCAGG AGCTGCGGTAGCTGCTGAATCTTCTACTGGTACATGGACAACTGTGTGGACCGATGGGCTTACCAGTCTTGATCGTTATA AAGGACGATGCTACGACATCGAGCCCGTTGCTGGAGAAGAAAATCAATATATTGCTTATGTAGCTTACCCCTTAGACCTT TTTGAAGAAGGTTCTGTTACTAACATGTTTACTTCCATTGTGGGTAATGTATTTGGGTTCAAAGCCCTACGCGCCCTACG TCTGGAGGATTTGCGAATCCCTACTGCTTATACTAAAACTTTCCAAGGGCCGCCTCATGGTATCCAAGTTGAGAGAGATA AATTGAACAAGTATGGTCGCCCCCTATTGGGTTGTACTATTAAACCTAAATTGGGGCTATCCGCTAAGAATTATGGTAGA GCGGTTTATGAATGTCTTCGCGGTGGACTTGATTTTACCAAAGATGATGAGAACGTGAATTCCCAACCATTTATGCGTTG GAGAGACCGTTTCTTATTTTGTGCCGAAGCAATTTATAAAGCACAGGCTGAAACAGGTGAAATCAAAGGACATTATTTGA ATGCTACTGCAGGTACATGTGAAGAAATGATCAAAAGGGCTGTATTTGCCAGAGAATTAGGAGTTCCTATCGTAATGCAT GACTACCTAACAGGGGGATTCACCGCAAATACTTCCTTGGCTCATTATTGCCGTGATAATGGTTTACTTCTTCACATTCA CCGCGCAATGCATGCAGTTATTGATAGACAGAAGAATCATGGTATGCATTTTCGTGTACTAGCTAAGGCGTTACGTTTGT CTGGTGGAGATCATATTCACGCTGGTACCGTAGTAGGTAAACTTGAAGGGGAAAGAGACATCACTTTGGGCTTTGTTGAT TTACTGCGTGATGATTTTATTGAAAAAGATCGAAGCCGCGGTATTTATTTCACTCAAGATTGGGTCTCTCTACCGGGTGT TTTGCCTGTAGCTTCAGGAGGTATTCACGTTTGGCATATGCCTGCTCTGACCGAGATCTTTGGAGATGATTCCGTACTAC AATTCGGTGGAGGAACTTTAGGGCACCCTTGGGGAAATGCACCTGGTGCCGTAGCTAATCGAGTAGCTCTAGAAGCATGT GTACAAGCTCGTAATGAAGGACGTGATCTTGCTCGTGAGGGTAATGAAATTATCCGTGAGGCTAGCAAATGGAGTCCTGA ACTAGCTGCTGCTTGTGAAGTATGGAAGGAGATTAAATTTGAATTCCAAGCGATGGATACTTTGTAAT
Product
Source
RefSeq
Link:
JCDBP00028
ID
JCDBP00028
Parent
JCDBR00048
Name
YP_002720120.1
Scaffold
NC_012224.1
CDS
60251-61678
Strand:
+
Sequence
MSPQTETKASVGFKAGVKDYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRY KGRCYDIEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYTKTFQGPPHGIQVERD KLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYL NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRL SGGDHIHAGTVVGKLEGERDITLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVL QFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNEIIREASKWSPELAAACEVWKEIKFEFQAMDTL
Product
ribulose-1%2C5-bisphosphate carboxylase/oxygenase large subunit
Source
RefSeq
Link
YP_002720120.1
InterProScan
IPR000685 Ribulose bisphosphate carboxylase, large subunit, C-terminal
IPR017443 Ribulose bisphosphate carboxylase, large subunit, ferrodoxin-like N-terminal
IPR020878 Ribulose bisphosphate carboxylase, large chain, active site
IPR020888 Ribulose bisphosphate carboxylase, large subunit
Pfam
PF02788.12 RuBisCO_large_N Domain
PF00016.16 RuBisCO_large Domain