Detail information of JCDBG00049

JCDBG00049
ID
JCDBG00049
Name
accD
Type
protein_coding
Scaffold
NC_012224.1
Start
62443
End
63924
Strand
+
Link
Genbank id:7564871 | Jatropha Genome Database ID:Jcr4U29862.20
Molecular function
GO:0003989 | acetyl-CoA carboxylase activity
Cellular component
GO:0009317 | acetyl-CoA carboxylase complex
Biological process
GO:0006633 | fatty acid biosynthetic process
KEGG
Entry: K01963
Name: accD
Definition: acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2]
ko00061:   Fatty acid biosynthesis
ko00253:   Tetracycline biosynthesis
ko00620:   Pyruvate metabolism
ko00640:   Propanoate metabolism
ko00720:   Carbon fixation pathways in prokaryotes
ko01200:   Carbon metabolism
ko01212:   Fatty acid metabolism
Source
RefSeq
TF
Description
Sequence
TGGAAAAACGGTGGTTCAATTCGATCTTATCCAATGTAGAATTAGGATACAGGTGTAGGTTAAGTAAATCAATGGATAGT TTTAGTCCTCTTGAAAATACCAGTATAAGCGAAGACCCAATTCTAAACGATACAGATAAAAACACCCATTGTTGGAGTAA TAGTGACAGCTCTAGTTACAGTAATGTTGATCATTTAGTTGGCATTCGGAATTTCAGCGTTGATGAAACTTTTTTAGTTA GGGATAGTAATAGGGACAGTTATTCCATATATTTTGATATTGAAAATCAAGTTTTTGAGATTGAAACTGATCATTCTTTT CTGAATGAACTAGAAAGTTCTTTTTATAGTTATTGGAATTCGAGTTATCTGAATAATGGGTCTAGCAGTGGTGACTTCCA CTATGATCATTATATGTCTGATACTAAATATAGTTGGAATAATTACATCAATAGTTGTATTGACAATTATCTTCGCTCTC AAATCTGTATTGATTTAAGTGGTAGTAACAATTACAGTGAGAGTTACATTTATAGTTACATTTGTGGTGAAAGTGGAAAT AGTAGTGAAAGTGAGAGTTCCAGTCTAAGAACTAGCACGAATGGTAGCGATTTAACTATAAGAGAAAGTTCTAATGATCT CGATATAACTCAAAAATACAAGCATTTGTGGGTTCAATGCGAAAATTGTTATGGATTAAACTATAAGAAATTTTTGAAGT CAAGAATGAATATTTGTGAACAATGTGGATATCATTTGAAAATGAGTAGTTCAGATAGAATTGAACTTTCGATTGACCTA GGCACTTGGAATCCTATGGATGAAGACATGGTATCTCTGGATCCCATTGAATTTCATTCAGAAGAGGAACCTTATAAAGA TCGTATTGATTCTTATCAAAAAAAGACAGGATTAACCGAGGCTGTTCAAACAGGCACAGGTCAACTAAACGGTATTCCCG TAGCAATTGGGGTTATGGATTTTCAGTTTATGGGGGGTAGTATGGGATCCGTAGTAGGGGAAAAAATCACCCGTTTGATT GAGTATGCTACCAATAAATTTTTACCTCTTATTTTAGTGTGTGCTTCCGGAGGAGCACGCATGCAAGAAGGAAGTTTGAG CTTGATGCAAATGGCTAAAATATCTTCTGCTTTATATGATTATCAATCGAATAAAAAGTTATTTTATGTATCAATCCTTA CATCTCCTACGACCGGCGGGGTGACAGCTAGTTTTGGTATGTTGGGGGATATCATTATTGCTGAACCTAACGCCTATATT GCATTTGCGGGTAAAAGAGTAATTGAACAAACATTGAATAAGACAGTACCTGAAGGTTCACAATCGGCTGAATTTTTATT CCATAAGGGTTTATTCGATCCAATCGTACCACGTAATCCTTTAAAAGGCGTTTTGAATGAGTTACTTCAGCTTCACGATT TCTTTCCTTTGAATCATAAATCAAGTAGAGCCTTAAGTTAAT
Gene structure

JCDB Genes gff download

JCDBG00049 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00049's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00049JCDBG02028co-exp-0.827488
JCDBG00049JCDBG02008co-exp-0.813241
JCDBG00049JCDBG01343co-exp-0.813007
JCDBG00049JCDBG17435co-exp0.811867
JCDBG00049JCDBG13661co-exp-0.809258
JCDBG00049JCDBG02226co-exp-0.807992
JCDBG00049JCDBG06355co-exp-0.798571
JCDBG00049JCDBG02352co-exp-0.798304
JCDBG00049JCDBG06781co-exp-0.798088
JCDBG00049JCDBG17228co-exp-0.797721
JCDBG02028JCDBG02008co-exp0.842717
JCDBG02028JCDBG01343co-exp0.845184
JCDBG02028JCDBG17435co-exp-0.855419
JCDBG02028JCDBG13661co-exp0.862372
JCDBG02028JCDBG02226co-exp0.789779
JCDBG02028JCDBG06355co-exp0.88278
JCDBG02028JCDBG02352co-exp0.882617
JCDBG02028JCDBG06781co-exp0.852018
JCDBG02028JCDBG17228co-exp0.882491
JCDBG02008JCDBG01343co-exp0.899685
JCDBG02008JCDBG17435co-exp-0.821184
JCDBG02008JCDBG13661co-exp0.844047
JCDBG02008JCDBG02226co-exp0.792563
JCDBG02008JCDBG06355co-exp0.795461
JCDBG02008JCDBG02352co-exp0.919258
JCDBG02008JCDBG06781co-exp0.865631
JCDBG02008JCDBG17228co-exp0.85684
JCDBG01343JCDBG17435co-exp-0.786524
JCDBG01343JCDBG13661co-exp0.797498
JCDBG01343JCDBG02226co-exp0.848569
JCDBG01343JCDBG06355co-exp0.773544
JCDBG01343JCDBG02352co-exp0.888326
JCDBG01343JCDBG06781co-exp0.833425
JCDBG01343JCDBG17228co-exp0.801244
JCDBG17435JCDBG13661co-exp-0.828019
JCDBG17435JCDBG02226co-exp-0.804493
JCDBG17435JCDBG06355co-exp-0.849253
JCDBG17435JCDBG02352co-exp-0.841979
JCDBG17435JCDBG06781co-exp-0.813754
JCDBG17435JCDBG17228co-exp-0.86697
JCDBG13661JCDBG02226co-exp0.826773
JCDBG13661JCDBG06355co-exp0.849126
JCDBG13661JCDBG02352co-exp0.858829
JCDBG13661JCDBG06781co-exp0.78496
JCDBG13661JCDBG17228co-exp0.860188
JCDBG02226JCDBG06355co-exp0.776329
JCDBG02226JCDBG02352co-exp0.781242
JCDBG02226JCDBG06781co-exp0.705535
JCDBG02226JCDBG17228co-exp0.749011
JCDBG06355JCDBG02352co-exp0.860574
JCDBG06355JCDBG06781co-exp0.81104
JCDBG06355JCDBG17228co-exp0.9017
JCDBG02352JCDBG06781co-exp0.90483
JCDBG02352JCDBG17228co-exp0.877323
JCDBG06781JCDBG17228co-exp0.829338
PPI network
node1node2type
JCDBG00049JCDBG21351PPI
JCDBG00049JCDBG16654PPI
JCDBG00049JCDBG09032PPI
JCDBG00049JCDBG24169PPI
JCDBG00049JCDBG15505PPI
JCDBG00049JCDBG14529PPI
JCDBG00049JCDBG17892PPI
JCDBG00049JCDBG18767PPI
JCDBG21351JCDBG16654PPI
JCDBG21351JCDBG15505PPI
JCDBG21351JCDBG18767PPI
JCDBG16654JCDBG24169PPI
JCDBG24169JCDBG17892PPI
JCDBG17892JCDBG18767PPI
JCDBR00049
ID
JCDBR00049
Name
accD
Type
protein_coding
Scaffold
NC_012224.1
Start
62443
End
63924
Strand
+
Exon
62443-63924
Sequence
TGGAAAAACGGTGGTTCAATTCGATCTTATCCAATGTAGAATTAGGATACAGGTGTAGGTTAAGTAAATCAATGGATAGT TTTAGTCCTCTTGAAAATACCAGTATAAGCGAAGACCCAATTCTAAACGATACAGATAAAAACACCCATTGTTGGAGTAA TAGTGACAGCTCTAGTTACAGTAATGTTGATCATTTAGTTGGCATTCGGAATTTCAGCGTTGATGAAACTTTTTTAGTTA GGGATAGTAATAGGGACAGTTATTCCATATATTTTGATATTGAAAATCAAGTTTTTGAGATTGAAACTGATCATTCTTTT CTGAATGAACTAGAAAGTTCTTTTTATAGTTATTGGAATTCGAGTTATCTGAATAATGGGTCTAGCAGTGGTGACTTCCA CTATGATCATTATATGTCTGATACTAAATATAGTTGGAATAATTACATCAATAGTTGTATTGACAATTATCTTCGCTCTC AAATCTGTATTGATTTAAGTGGTAGTAACAATTACAGTGAGAGTTACATTTATAGTTACATTTGTGGTGAAAGTGGAAAT AGTAGTGAAAGTGAGAGTTCCAGTCTAAGAACTAGCACGAATGGTAGCGATTTAACTATAAGAGAAAGTTCTAATGATCT CGATATAACTCAAAAATACAAGCATTTGTGGGTTCAATGCGAAAATTGTTATGGATTAAACTATAAGAAATTTTTGAAGT CAAGAATGAATATTTGTGAACAATGTGGATATCATTTGAAAATGAGTAGTTCAGATAGAATTGAACTTTCGATTGACCTA GGCACTTGGAATCCTATGGATGAAGACATGGTATCTCTGGATCCCATTGAATTTCATTCAGAAGAGGAACCTTATAAAGA TCGTATTGATTCTTATCAAAAAAAGACAGGATTAACCGAGGCTGTTCAAACAGGCACAGGTCAACTAAACGGTATTCCCG TAGCAATTGGGGTTATGGATTTTCAGTTTATGGGGGGTAGTATGGGATCCGTAGTAGGGGAAAAAATCACCCGTTTGATT GAGTATGCTACCAATAAATTTTTACCTCTTATTTTAGTGTGTGCTTCCGGAGGAGCACGCATGCAAGAAGGAAGTTTGAG CTTGATGCAAATGGCTAAAATATCTTCTGCTTTATATGATTATCAATCGAATAAAAAGTTATTTTATGTATCAATCCTTA CATCTCCTACGACCGGCGGGGTGACAGCTAGTTTTGGTATGTTGGGGGATATCATTATTGCTGAACCTAACGCCTATATT GCATTTGCGGGTAAAAGAGTAATTGAACAAACATTGAATAAGACAGTACCTGAAGGTTCACAATCGGCTGAATTTTTATT CCATAAGGGTTTATTCGATCCAATCGTACCACGTAATCCTTTAAAAGGCGTTTTGAATGAGTTACTTCAGCTTCACGATT TCTTTCCTTTGAATCATAAATCAAGTAGAGCCTTAAGTTAAT
Product
Source
RefSeq
Link:
JCDBP00029
ID
JCDBP00029
Parent
JCDBR00049
Name
YP_002720121.1
Scaffold
NC_012224.1
CDS
62443-63924
Strand:
+
Sequence
MEKRWFNSILSNVELGYRCRLSKSMDSFSPLENTSISEDPILNDTDKNTHCWSNSDSSSYSNVDHLVGIRNFSVDETFLV RDSNRDSYSIYFDIENQVFEIETDHSFLNELESSFYSYWNSSYLNNGSSSGDFHYDHYMSDTKYSWNNYINSCIDNYLRS QICIDLSGSNNYSESYIYSYICGESGNSSESESSSLRTSTNGSDLTIRESSNDLDITQKYKHLWVQCENCYGLNYKKFLK SRMNICEQCGYHLKMSSSDRIELSIDLGTWNPMDEDMVSLDPIEFHSEEEPYKDRIDSYQKKTGLTEAVQTGTGQLNGIP VAIGVMDFQFMGGSMGSVVGEKITRLIEYATNKFLPLILVCASGGARMQEGSLSLMQMAKISSALYDYQSNKKLFYVSIL TSPTTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTLNKTVPEGSQSAEFLFHKGLFDPIVPRNPLKGVLNELLQLHD FFPLNHKSSRALS
Product
acetyl-CoA carboxylase beta subunit
Source
RefSeq
Link
YP_002720121.1
InterProScan
IPR000022 Carboxyl transferase
IPR000438 Acetyl-CoA carboxylase carboxyl transferase, beta subunit
IPR011762 Acetyl-coenzyme A carboxyltransferase, N-terminal
IPR029045 ClpP/crotonase-like domain
Pfam
PF01039.18 Carboxyl_trans Family