Detail information of JCDBG00050

JCDBG00050
ID
JCDBG00050
Name
psaI
Type
protein_coding
Scaffold
NC_012224.1
Start
64938
End
65060
Strand
+
Link
Genbank id:7564872
Molecular function
Cellular component
GO:0009522 | photosystem I
Biological process
GO:0015979 | photosynthesis
KEGG
Entry: K02696
Name: psaI
Definition: photosystem I subunit VIII
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGACAATTCTTAACAACCTACCCTCCATTTTTGTGCCTTTAGTGGGCTTAGTATTTCCGGCAATTGCAATGGCTTCTTTA TCTCTTCATGTTCAAAAAACAAGATTGTTTAGATCTGATTAGG
Gene structure

JCDB Genes gff download

JCDBG00050 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00050's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00050JCDBG00062co-exp0.929095
JCDBG00050JCDBG00075co-exp0.919816
JCDBG00050JCDBG00059co-exp0.913866
JCDBG00050JCDBG00028co-exp0.913276
JCDBG00050JCDBG04360co-exp0.907182
JCDBG00050JCDBG00065co-exp0.904811
JCDBG00050JCDBG00777co-exp0.899601
JCDBG00050JCDBG18716co-exp0.899046
JCDBG00050JCDBG16033co-exp0.897872
JCDBG00050JCDBG00037co-exp0.895607
JCDBG00062JCDBG00075co-exp0.905767
JCDBG00062JCDBG00059co-exp0.900039
JCDBG00062JCDBG00028co-exp0.880102
JCDBG00062JCDBG04360co-exp0.887609
JCDBG00062JCDBG00065co-exp0.946062
JCDBG00062JCDBG00777co-exp0.892505
JCDBG00062JCDBG18716co-exp0.889956
JCDBG00062JCDBG16033co-exp0.885142
JCDBG00062JCDBG00037co-exp0.934869
JCDBG00075JCDBG00059co-exp0.844734
JCDBG00075JCDBG00028co-exp0.851903
JCDBG00075JCDBG04360co-exp0.920042
JCDBG00075JCDBG00065co-exp0.920844
JCDBG00075JCDBG00777co-exp0.900444
JCDBG00075JCDBG18716co-exp0.940498
JCDBG00075JCDBG16033co-exp0.901603
JCDBG00075JCDBG00037co-exp0.939222
JCDBG00059JCDBG00028co-exp0.859519
JCDBG00059JCDBG04360co-exp0.812381
JCDBG00059JCDBG00065co-exp0.854837
JCDBG00059JCDBG00777co-exp0.839312
JCDBG00059JCDBG18716co-exp0.805746
JCDBG00059JCDBG16033co-exp0.798933
JCDBG00059JCDBG00037co-exp0.836578
JCDBG00028JCDBG04360co-exp0.808959
JCDBG00028JCDBG00065co-exp0.836263
JCDBG00028JCDBG00777co-exp0.825133
JCDBG00028JCDBG18716co-exp0.847572
JCDBG00028JCDBG16033co-exp0.838151
JCDBG00028JCDBG00037co-exp0.817444
JCDBG04360JCDBG00065co-exp0.916325
JCDBG04360JCDBG00777co-exp0.866794
JCDBG04360JCDBG18716co-exp0.92204
JCDBG04360JCDBG16033co-exp0.932676
JCDBG04360JCDBG00037co-exp0.919883
JCDBG00065JCDBG00777co-exp0.850414
JCDBG00065JCDBG18716co-exp0.886142
JCDBG00065JCDBG16033co-exp0.898554
JCDBG00065JCDBG00037co-exp0.962165
JCDBG00777JCDBG18716co-exp0.893376
JCDBG00777JCDBG16033co-exp0.857037
JCDBG00777JCDBG00037co-exp0.859529
JCDBG18716JCDBG16033co-exp0.902267
JCDBG18716JCDBG00037co-exp0.885156
JCDBG16033JCDBG00037co-exp0.914596
PPI network
node1node2type
JCDBR00050
ID
JCDBR00050
Name
psaI
Type
protein_coding
Scaffold
NC_012224.1
Start
64938
End
65060
Strand
+
Exon
64938-65060
Sequence
TGACAATTCTTAACAACCTACCCTCCATTTTTGTGCCTTTAGTGGGCTTAGTATTTCCGGCAATTGCAATGGCTTCTTTA TCTCTTCATGTTCAAAAAACAAGATTGTTTAGATCTGATTAGG
Product
Source
RefSeq
Link:
JCDBP00030
ID
JCDBP00030
Parent
JCDBR00050
Name
YP_002720122.1
Scaffold
NC_012224.1
CDS
64938-65060
Strand:
+
Sequence
MTILNNLPSIFVPLVGLVFPAIAMASLSLHVQKTRLFRSD
Product
psaI
Source
RefSeq
Link
YP_002720122.1
InterProScan
IPR001302 Photosystem I PsaI, reaction centre subunit VIII
Pfam
PF00796.14 PSI_8 Family