Detail information of JCDBG00051

JCDBG00051
ID
JCDBG00051
Name
ycf4
Type
protein_coding
Scaffold
NC_012224.1
Start
65493
End
66047
Strand
+
Link
Genbank id:7564873 | Jatropha Genome Database ID:Jcr4S09385.50
Molecular function
Cellular component
GO:0016021 | integral component of membrane
GO:0009579 | thylakoid
GO:0009522 | photosystem I
Biological process
GO:0015979 | photosynthesis
KEGG
Source
RefSeq
TF
Description
Sequence
TGAGTTGGCGATCAGAACGTATATGGATAGAACTTATAGCGGGGTCTCGAAAAACAAGTAATTTCTGCTGGGCCCTTATA CTTTTTTTAGGTTCATTGGGTTTTTTTTTGGTTGGAATTTCCAGTTATCTTGGCAAAAATTTGATATCTTTATTTCCATC TCAGCAAATAATTTTTTTTCCACAAGGGATCGTGATGTCTTTCTATGGGATCGCCGGTCTATTTATTAGTTCTTATTTGT GGTGCACAATTTTGTGGAATGTAGGTAGTGGTTATGATCGATTCGATAGAAAAGAAGGAATAGTGTGTATTTTTCGCTGG GGATTTCCTGGAAAAAATCGTCGCATCTTACTCCGATTCCTTATGAAAGATATTCAGTCTATTAGGCTAGAAGTTAAAGA GGGTATTTACGCTCGGCGTGCCCTTTATATGGAAATCCGAGGCCGGGGGGCCATTCCTTTGACTCGTACTGATGAGAATT TGACTCCGCGAGAAATTGAGCAAAAAGTAGCCGAATTGGCCTATTTTTTGCGTGTACCAATTGAAGTATTTTGAA
Gene structure

JCDB Genes gff download

JCDBG00051 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00051
ID
JCDBR00051
Name
ycf4
Type
protein_coding
Scaffold
NC_012224.1
Start
65493
End
66047
Strand
+
Exon
65493-66047
Sequence
TGAGTTGGCGATCAGAACGTATATGGATAGAACTTATAGCGGGGTCTCGAAAAACAAGTAATTTCTGCTGGGCCCTTATA CTTTTTTTAGGTTCATTGGGTTTTTTTTTGGTTGGAATTTCCAGTTATCTTGGCAAAAATTTGATATCTTTATTTCCATC TCAGCAAATAATTTTTTTTCCACAAGGGATCGTGATGTCTTTCTATGGGATCGCCGGTCTATTTATTAGTTCTTATTTGT GGTGCACAATTTTGTGGAATGTAGGTAGTGGTTATGATCGATTCGATAGAAAAGAAGGAATAGTGTGTATTTTTCGCTGG GGATTTCCTGGAAAAAATCGTCGCATCTTACTCCGATTCCTTATGAAAGATATTCAGTCTATTAGGCTAGAAGTTAAAGA GGGTATTTACGCTCGGCGTGCCCTTTATATGGAAATCCGAGGCCGGGGGGCCATTCCTTTGACTCGTACTGATGAGAATT TGACTCCGCGAGAAATTGAGCAAAAAGTAGCCGAATTGGCCTATTTTTTGCGTGTACCAATTGAAGTATTTTGAA
Product
Source
RefSeq
Link:
JCDBP00031
ID
JCDBP00031
Parent
JCDBR00051
Name
YP_002720123.1
Scaffold
NC_012224.1
CDS
65493-66047
Strand:
+
Sequence
MSWRSERIWIELIAGSRKTSNFCWALILFLGSLGFFLVGISSYLGKNLISLFPSQQIIFFPQGIVMSFYGIAGLFISSYL WCTILWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRILLRFLMKDIQSIRLEVKEGIYARRALYMEIRGRGAIPLTRTDEN LTPREIEQKVAELAYFLRVPIEVF
Product
photosystem I assembly protein Ycf4
Source
RefSeq
Link
YP_002720123.1
InterProScan
IPR003359 Photosystem I Ycf4, assembly
Pfam
PF02392.12 Ycf4 Family