Detail information of JCDBG00052

JCDBG00052
ID
JCDBG00052
Name
cemA
Type
protein_coding
Scaffold
NC_012224.1
Start
66653
End
67342
Strand
+
Link
Genbank id:7564874 | Jatropha Genome Database ID:Jcr4U29440.10
Molecular function
Cellular component
GO:0016021 | integral component of membrane
Biological process
KEGG
Source
RefSeq
TF
Description
Sequence
TGAAAAGAAAAGCATTTATTCCCCTTCTATATCTTACATCTATAGTTTTTTTGCCCTGGTGGATCTCTTTTTTTTCTTTT AATAAAAGTTTTGAATCTTGGGTTATTAATTGGTGTAATACTAGTAAATCCGAAACTTTTTTAAATGATATCCAAGAAAA AAGTATTCTAGAAAAATTCATAGAATTAGAGGAACTCGTTCGCTTGGACGAAATGATAAAGGAATACCCGGAAACACATC TACAAGGGTTTCGTACCGGAATCCACAAAGAAACGATCCAATTGATCAAGATGCACAATGAAGATCGTATCCATACGATT TTACACTTCTCGACAAATATAATCTGTTTCGTTATTCTAAGTGGGTATTCTATTCTAAGTAATGAAGAACTTATTATTCT TAATTCGTGGGTTCAAGAATTCCTATATAACTTAAGCGACACAATAAAAGCTTTTTCAATTCTTTTATTAACCGATTTAT GTATAGGATTCCACTCACCCCACGGTTGGGAACTAATGATTGGCTCTGTCTACAAAGATTTTGGATTTGCTCATAATGAT CAAATTATATCTGGCCTTGTTTCCACTTTTCCAGTCATTCTCGATACAATTTTTAAATATTGGATTTTCCGTTATTTAAA TCGTGTATCTCCGTCACTTGTAGTGATTTATCATTCAATGAATGACTGAA
Gene structure

JCDB Genes gff download

JCDBG00052 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00052's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00052JCDBG00053co-exp0.847295
PPI network
node1node2type
JCDBR00052
ID
JCDBR00052
Name
cemA
Type
protein_coding
Scaffold
NC_012224.1
Start
66653
End
67342
Strand
+
Exon
66653-67342
Sequence
TGAAAAGAAAAGCATTTATTCCCCTTCTATATCTTACATCTATAGTTTTTTTGCCCTGGTGGATCTCTTTTTTTTCTTTT AATAAAAGTTTTGAATCTTGGGTTATTAATTGGTGTAATACTAGTAAATCCGAAACTTTTTTAAATGATATCCAAGAAAA AAGTATTCTAGAAAAATTCATAGAATTAGAGGAACTCGTTCGCTTGGACGAAATGATAAAGGAATACCCGGAAACACATC TACAAGGGTTTCGTACCGGAATCCACAAAGAAACGATCCAATTGATCAAGATGCACAATGAAGATCGTATCCATACGATT TTACACTTCTCGACAAATATAATCTGTTTCGTTATTCTAAGTGGGTATTCTATTCTAAGTAATGAAGAACTTATTATTCT TAATTCGTGGGTTCAAGAATTCCTATATAACTTAAGCGACACAATAAAAGCTTTTTCAATTCTTTTATTAACCGATTTAT GTATAGGATTCCACTCACCCCACGGTTGGGAACTAATGATTGGCTCTGTCTACAAAGATTTTGGATTTGCTCATAATGAT CAAATTATATCTGGCCTTGTTTCCACTTTTCCAGTCATTCTCGATACAATTTTTAAATATTGGATTTTCCGTTATTTAAA TCGTGTATCTCCGTCACTTGTAGTGATTTATCATTCAATGAATGACTGAA
Product
Source
RefSeq
Link:
JCDBP00032
ID
JCDBP00032
Parent
JCDBR00052
Name
YP_002720124.1
Scaffold
NC_012224.1
CDS
66653-67342
Strand:
+
Sequence
MKRKAFIPLLYLTSIVFLPWWISFFSFNKSFESWVINWCNTSKSETFLNDIQEKSILEKFIELEELVRLDEMIKEYPETH LQGFRTGIHKETIQLIKMHNEDRIHTILHFSTNIICFVILSGYSILSNEELIILNSWVQEFLYNLSDTIKAFSILLLTDL CIGFHSPHGWELMIGSVYKDFGFAHNDQIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND
Product
envelope membrane protein
Source
RefSeq
Link
YP_002720124.1
InterProScan
IPR004282 Chloroplast envelope membrane protein, CemA
Pfam
PF03040.10 CemA Family