Detail information of JCDBG00053

JCDBG00053
ID
JCDBG00053
Name
petA
Type
protein_coding
Scaffold
NC_012224.1
Start
67604
End
68566
Strand
+
Link
Genbank id:7564875 | Jatropha Genome Database ID:Jcr4S09385.70
Molecular function
GO:0009055 | electron carrier activity
GO:0020037 | heme binding
GO:0005506 | iron ion binding
Cellular component
GO:0031361 | integral component of thylakoid membrane
Biological process
GO:0015979 | photosynthesis
KEGG
Entry: K02634
Name: petA
Definition: apocytochrome f
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGCAAACTAGAAAGACCTTCTCTTGGATAAAGGAAGAGATTACTCGTTCCATTTCTGTATCGCTCATGGTATATATAATA ACTTGGGCATCCATTTCAAACGCATATCCCATTTTTGCACAGCAGGGTTATGAAAATCCACGCGAAGCAACTGGCCGTAT TGTATGTGCCAATTGTCATTTAGCTAATAAGCCCGTGGATATTGAGGTTCCACAGGCGGTACTTCCTGATACTGTATTTG AAGCAGTTGTTCGAATCCCTTATGATATGCAACTGAAACAAGTTCTTGCTAATGGTAAAAAAGGAGCTTTGAACGTGGGG GCTGTTCTTATTTTACCTGAGGGGTTTGAATTAGCCCCTCCCGATCGTATTTCGCCAGAGATTAAAGAAAAGATGGGAAA TCTGTCTTTTCAGAGTTATCGCCCCACTAAAAAAAATATTCTTGTAATAGGCCCTGTTCCTGGTCAGAAATATAGTGAAA TTACCTTTCCTATTCTGTCTCCGGACCCCGCCACTAAGAAAGATGTTCGTTTTTTAAAATATCCCATATATGTAGGCGGA AACAGGGGAAGGGGTCAGATTTATCCCGACGGGAGCAAGAGTAACAATACGGTTTATAATGCTACAGCAGCAGGTATAGT AAGCAAAATCATACGAAAAGAAAAAGGGGGGTACGAAATAACCATAACGGATGCGTCAGAGGGACGTCAAGTGATTGATA TTATACCTCCAGGGCCAGAACTTCTTGTTTCAGAAGGCGAATCCATCAAACTGGATCAACCATTAACGAGTAATCCTAAT GTGGGTGGATTTGGTCAGGGAGATGCAGAAATAGTGCTTCAAGACCCATTACGTGTCCAAGGGCTTTTTTTCTTCTTGGC ATCCGTTATTTTGGCACAAATCTTTTTGGTTCTTAAAAAGAAACAGTTTGAGAAGGTTCAATTGTCCGAAATGAATTTTT AGA
Gene structure

JCDB Genes gff download

JCDBG00053 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00053's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00053JCDBG00052co-exp0.847295
JCDBG00053JCDBG00039co-exp0.680567
JCDBG00053JCDBG18679co-exp0.680457
JCDBG00053JCDBG21393co-exp0.666341
JCDBG00053JCDBG00044co-exp0.619919
JCDBG00039JCDBG18679co-exp0.804922
JCDBG00039JCDBG21393co-exp0.776809
JCDBG00039JCDBG00044co-exp0.91683
JCDBG18679JCDBG21393co-exp0.781255
JCDBG18679JCDBG00044co-exp0.736685
JCDBG21393JCDBG00044co-exp0.716597
PPI network
node1node2type
JCDBR00053
ID
JCDBR00053
Name
petA
Type
protein_coding
Scaffold
NC_012224.1
Start
67604
End
68566
Strand
+
Exon
67604-68566
Sequence
TGCAAACTAGAAAGACCTTCTCTTGGATAAAGGAAGAGATTACTCGTTCCATTTCTGTATCGCTCATGGTATATATAATA ACTTGGGCATCCATTTCAAACGCATATCCCATTTTTGCACAGCAGGGTTATGAAAATCCACGCGAAGCAACTGGCCGTAT TGTATGTGCCAATTGTCATTTAGCTAATAAGCCCGTGGATATTGAGGTTCCACAGGCGGTACTTCCTGATACTGTATTTG AAGCAGTTGTTCGAATCCCTTATGATATGCAACTGAAACAAGTTCTTGCTAATGGTAAAAAAGGAGCTTTGAACGTGGGG GCTGTTCTTATTTTACCTGAGGGGTTTGAATTAGCCCCTCCCGATCGTATTTCGCCAGAGATTAAAGAAAAGATGGGAAA TCTGTCTTTTCAGAGTTATCGCCCCACTAAAAAAAATATTCTTGTAATAGGCCCTGTTCCTGGTCAGAAATATAGTGAAA TTACCTTTCCTATTCTGTCTCCGGACCCCGCCACTAAGAAAGATGTTCGTTTTTTAAAATATCCCATATATGTAGGCGGA AACAGGGGAAGGGGTCAGATTTATCCCGACGGGAGCAAGAGTAACAATACGGTTTATAATGCTACAGCAGCAGGTATAGT AAGCAAAATCATACGAAAAGAAAAAGGGGGGTACGAAATAACCATAACGGATGCGTCAGAGGGACGTCAAGTGATTGATA TTATACCTCCAGGGCCAGAACTTCTTGTTTCAGAAGGCGAATCCATCAAACTGGATCAACCATTAACGAGTAATCCTAAT GTGGGTGGATTTGGTCAGGGAGATGCAGAAATAGTGCTTCAAGACCCATTACGTGTCCAAGGGCTTTTTTTCTTCTTGGC ATCCGTTATTTTGGCACAAATCTTTTTGGTTCTTAAAAAGAAACAGTTTGAGAAGGTTCAATTGTCCGAAATGAATTTTT AGA
Product
Source
RefSeq
Link:
JCDBP00033
ID
JCDBP00033
Parent
JCDBR00053
Name
YP_002720125.1
Scaffold
NC_012224.1
CDS
67604-68566
Strand:
+
Sequence
MQTRKTFSWIKEEITRSISVSLMVYIITWASISNAYPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVF EAVVRIPYDMQLKQVLANGKKGALNVGAVLILPEGFELAPPDRISPEIKEKMGNLSFQSYRPTKKNILVIGPVPGQKYSE ITFPILSPDPATKKDVRFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRKEKGGYEITITDASEGRQVID IIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLFFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Product
cytochrome f
Source
RefSeq
Link
YP_002720125.1
InterProScan
IPR002325 Cytochrome f
IPR011054 Rudiment single hybrid motif
IPR024058 Cytochrome f transmembrane anchor
IPR024094 Cytochrome f large domain
Pfam
PF16639.1 Apocytochr_F_N Domain
PF01333.15 Apocytochr_F_C Domain