Detail information of JCDBG00054

JCDBG00054
ID
JCDBG00054
Name
psbJ
Type
protein_coding
Scaffold
NC_012224.1
Start
69656
End
69778
Strand
-
Link
Genbank id:7564876
Molecular function
Cellular component
GO:0016020 | membrane
GO:0009539 | photosystem II reaction center
GO:0009523 | photosystem II
Biological process
GO:0015979 | photosynthesis
KEGG
Source
RefSeq
TF
Description
Sequence
AATGGCCGATACTACTGGAAGAATTCCTCTTTGGATAATAGGTACTGTAACCGGTATTCTTGTGATCGGTTTAATAGGCA TTTTCTTTTATGGTTCATATTCCGGATTGGGTTCATCCCTGTA
Gene structure

JCDB Genes gff download

JCDBG00054 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00054
ID
JCDBR00054
Name
psbJ
Type
protein_coding
Scaffold
NC_012224.1
Start
69656
End
69778
Strand
-
Exon
69656-69778
Sequence
AATGGCCGATACTACTGGAAGAATTCCTCTTTGGATAATAGGTACTGTAACCGGTATTCTTGTGATCGGTTTAATAGGCA TTTTCTTTTATGGTTCATATTCCGGATTGGGTTCATCCCTGTA
Product
Source
RefSeq
Link:
JCDBP00034
ID
JCDBP00034
Parent
JCDBR00054
Name
YP_002720126.1
Scaffold
NC_012224.1
CDS
69656-69778
Strand:
-
Sequence
MADTTGRIPLWIIGTVTGILVIGLIGIFFYGSYSGLGSSL
Product
psbJ
Source
RefSeq
Link
YP_002720126.1
InterProScan
IPR002682 Photosystem II PsbJ
Pfam
PF01788.13 PsbJ Family