Detail information of JCDBG00055

JCDBG00055
ID
JCDBG00055
Name
psbL
Type
protein_coding
Scaffold
NC_012224.1
Start
69928
End
70044
Strand
-
Link
Genbank id:7564877
Molecular function
Cellular component
GO:0016020 | membrane
GO:0009539 | photosystem II reaction center
GO:0009523 | photosystem II
Biological process
GO:0015979 | photosynthesis
KEGG
Entry: K02713
Name: psbL
Definition: photosystem II PsbL protein
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TATGACACAATCAAACCCGAACGAACAAAATGTTGAATTGAATCGTACCAGTCTCTACTGGGGGTTATTGCTCATTTTTG TACTTGCTGTTTTATTTTCTAATTATTTCTTCAATTA
Gene structure

JCDB Genes gff download

JCDBG00055 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00055
ID
JCDBR00055
Name
psbL
Type
protein_coding
Scaffold
NC_012224.1
Start
69928
End
70044
Strand
-
Exon
69928-70044
Sequence
TATGACACAATCAAACCCGAACGAACAAAATGTTGAATTGAATCGTACCAGTCTCTACTGGGGGTTATTGCTCATTTTTG TACTTGCTGTTTTATTTTCTAATTATTTCTTCAATTA
Product
Source
RefSeq
Link:
JCDBP00035
ID
JCDBP00035
Parent
JCDBR00055
Name
YP_002720127.1
Scaffold
NC_012224.1
CDS
69928-70044
Strand:
-
Sequence
MTQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFN
Product
photosystem II protein L
Source
RefSeq
Link
YP_002720127.1
InterProScan
IPR003372 Photosystem II PsbL
Pfam
PF02419.13 PsbL Family