Detail information of JCDBG00056

JCDBG00056
ID
JCDBG00056
Name
psbF
Type
protein_coding
Scaffold
NC_012224.1
Start
70071
End
70190
Strand
-
Link
Genbank id:7564878
Molecular function
GO:0020037 | heme binding
Cellular component
GO:0009539 | photosystem II reaction center
GO:0009523 | photosystem II
GO:0016021 | integral component of membrane
Biological process
GO:0019684 | photosynthesis, light reaction
GO:0009767 | photosynthetic electron transport chain
GO:0015979 | photosynthesis
KEGG
Entry: K02708
Name: psbF
Definition: photosystem II cytochrome b559 subunit beta
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
AATGACCATAGATCGAACCTATCCAATTTTTACAGTACGATGGTTGGCTGTTCACGGATTAGCTGTACCTACCGTTTCTT TTTTGGGGTCAATATCAGCAATGCAGTTCATCCAACGATA
Gene structure

JCDB Genes gff download

JCDBG00056 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00056
ID
JCDBR00056
Name
psbF
Type
protein_coding
Scaffold
NC_012224.1
Start
70071
End
70190
Strand
-
Exon
70071-70190
Sequence
AATGACCATAGATCGAACCTATCCAATTTTTACAGTACGATGGTTGGCTGTTCACGGATTAGCTGTACCTACCGTTTCTT TTTTGGGGTCAATATCAGCAATGCAGTTCATCCAACGATA
Product
Source
RefSeq
Link:
JCDBP00036
ID
JCDBP00036
Parent
JCDBR00056
Name
YP_002720128.1
Scaffold
NC_012224.1
CDS
70071-70190
Strand:
-
Sequence
MTIDRTYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR
Product
photosystem II protein VI
Source
RefSeq
Link
YP_002720128.1
InterProScan
IPR006216 Photosystem II cytochrome b559, conserved site
IPR006241 Photosystem II cytochrome b559, beta subunit
IPR013081 Photosystem II cytochrome b559, N-terminal
Pfam
PF00283.15 Cytochrom_B559 Family