Detail information of JCDBG00057

JCDBG00057
ID
JCDBG00057
Name
psbE
Type
protein_coding
Scaffold
NC_012224.1
Start
70199
End
70450
Strand
-
Link
Genbank id:7564879
Molecular function
GO:0020037 | heme binding
GO:0046872 | metal ion binding
Cellular component
GO:0009539 | photosystem II reaction center
GO:0009523 | photosystem II
GO:0016021 | integral component of membrane
Biological process
GO:0019684 | photosynthesis, light reaction
GO:0009767 | photosynthetic electron transport chain
GO:0015979 | photosynthesis
KEGG
Entry: K02707
Name: psbE
Definition: photosystem II cytochrome b559 subunit alpha
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TATGTCTGGAAGCACAGGAGAACGTTCTTTTGCTGATATTATTACCAGTATTCGATATTGGGTCATTCATAGCATTACTA TACCTTCCCTATTCATTGCAGGTTGGTTATTCGTCAGCACGGGTTTAGCTTACGATGTATTTGGAAGCCCTCGTCCAAAT GAATATTTTACAGAGAGCCGACAAGGAATTCCATTAATAACTGGCCGTTTTGATCCTTTGGAACAACTCGATGAATTTAG TAAATCTTTTTA
Gene structure

JCDB Genes gff download

JCDBG00057 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00057
ID
JCDBR00057
Name
psbE
Type
protein_coding
Scaffold
NC_012224.1
Start
70199
End
70450
Strand
-
Exon
70199-70450
Sequence
TATGTCTGGAAGCACAGGAGAACGTTCTTTTGCTGATATTATTACCAGTATTCGATATTGGGTCATTCATAGCATTACTA TACCTTCCCTATTCATTGCAGGTTGGTTATTCGTCAGCACGGGTTTAGCTTACGATGTATTTGGAAGCCCTCGTCCAAAT GAATATTTTACAGAGAGCCGACAAGGAATTCCATTAATAACTGGCCGTTTTGATCCTTTGGAACAACTCGATGAATTTAG TAAATCTTTTTA
Product
Source
RefSeq
Link:
JCDBP00037
ID
JCDBP00037
Parent
JCDBR00057
Name
YP_002720129.1
Scaffold
NC_012224.1
CDS
70199-70450
Strand:
-
Sequence
MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDPLEQLDEFS KSF
Product
photosystem II protein V
Source
RefSeq
Link
YP_002720129.1
InterProScan
IPR006216 Photosystem II cytochrome b559, conserved site
IPR006217 Photosystem II cytochrome b559, alpha subunit
IPR013081 Photosystem II cytochrome b559, N-terminal
IPR013082 Photosystem II cytochrome b559, alpha subunit, lumenal region
Pfam
PF00283.15 Cytochrom_B559 Family
PF00284.16 Cytochrom_B559a Family