Detail information of JCDBG00058

JCDBG00058
ID
JCDBG00058
Name
petL
Type
protein_coding
Scaffold
NC_012224.1
Start
71834
End
71929
Strand
+
Link
Genbank id:7564880
Molecular function
GO:0009055 | electron carrier activity
Cellular component
GO:0009512 | cytochrome b6f complex
Biological process
KEGG
Source
RefSeq
TF
Description
Sequence
TGCCTACTATAACTAGTTATTTCGGTTTTCTACTAGCGGCTTTAACTATAACCTCAGTTCTATTTATTGGTCTGAGCAAG ATACGGCTTATTTGAA
Gene structure

JCDB Genes gff download

JCDBG00058 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00058's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00058JCDBG03735co-exp0.742358
JCDBG00058JCDBG06749co-exp0.742063
JCDBG00058JCDBG19008co-exp0.73855
JCDBG00058JCDBG10445co-exp0.737676
JCDBG00058JCDBG09510co-exp0.732564
JCDBG00058JCDBG09415co-exp0.731077
JCDBG00058JCDBG19491co-exp0.730729
JCDBG00058JCDBG15896co-exp0.729872
JCDBG00058JCDBG00757co-exp0.728425
JCDBG00058JCDBG21805co-exp0.727545
JCDBG03735JCDBG06749co-exp0.733896
JCDBG03735JCDBG19008co-exp0.708004
JCDBG03735JCDBG10445co-exp0.739888
JCDBG03735JCDBG09510co-exp0.821768
JCDBG03735JCDBG09415co-exp0.781907
JCDBG03735JCDBG19491co-exp0.715638
JCDBG03735JCDBG15896co-exp0.730848
JCDBG03735JCDBG00757co-exp0.727309
JCDBG03735JCDBG21805co-exp0.706198
JCDBG06749JCDBG19008co-exp0.862729
JCDBG06749JCDBG10445co-exp0.900952
JCDBG06749JCDBG09510co-exp0.896115
JCDBG06749JCDBG09415co-exp0.952161
JCDBG06749JCDBG19491co-exp0.897354
JCDBG06749JCDBG15896co-exp0.940099
JCDBG06749JCDBG00757co-exp0.856037
JCDBG06749JCDBG21805co-exp0.895736
JCDBG19008JCDBG10445co-exp0.83364
JCDBG19008JCDBG09510co-exp0.774249
JCDBG19008JCDBG09415co-exp0.834315
JCDBG19008JCDBG19491co-exp0.837963
JCDBG19008JCDBG15896co-exp0.902847
JCDBG19008JCDBG00757co-exp0.823768
JCDBG19008JCDBG21805co-exp0.832299
JCDBG10445JCDBG09510co-exp0.847909
JCDBG10445JCDBG09415co-exp0.903259
JCDBG10445JCDBG19491co-exp0.819571
JCDBG10445JCDBG15896co-exp0.895981
JCDBG10445JCDBG00757co-exp0.857945
JCDBG10445JCDBG21805co-exp0.878558
JCDBG09510JCDBG09415co-exp0.927694
JCDBG09510JCDBG19491co-exp0.797936
JCDBG09510JCDBG15896co-exp0.828954
JCDBG09510JCDBG00757co-exp0.810003
JCDBG09510JCDBG21805co-exp0.838134
JCDBG09415JCDBG19491co-exp0.860241
JCDBG09415JCDBG15896co-exp0.91409
JCDBG09415JCDBG00757co-exp0.894795
JCDBG09415JCDBG21805co-exp0.898755
JCDBG19491JCDBG15896co-exp0.897728
JCDBG19491JCDBG00757co-exp0.779597
JCDBG19491JCDBG21805co-exp0.834785
JCDBG15896JCDBG00757co-exp0.844166
JCDBG15896JCDBG21805co-exp0.877014
JCDBG00757JCDBG21805co-exp0.846887
PPI network
node1node2type
JCDBR00058
ID
JCDBR00058
Name
petL
Type
protein_coding
Scaffold
NC_012224.1
Start
71834
End
71929
Strand
+
Exon
71834-71929
Sequence
TGCCTACTATAACTAGTTATTTCGGTTTTCTACTAGCGGCTTTAACTATAACCTCAGTTCTATTTATTGGTCTGAGCAAG ATACGGCTTATTTGAA
Product
Source
RefSeq
Link:
JCDBP00038
ID
JCDBP00038
Parent
JCDBR00058
Name
YP_002720130.1
Scaffold
NC_012224.1
CDS
71834-71929
Strand:
+
Sequence
MPTITSYFGFLLAALTITSVLFIGLSKIRLI
Product
cytochrome b6/f complex subunit VI
Source
RefSeq
Link
YP_002720130.1
InterProScan
IPR007802 Cytochrome b6-f complex subunit 6
Pfam
PF05115.10 PetL Family