Detail information of JCDBG00059

JCDBG00059
ID
JCDBG00059
Name
petG
Type
protein_coding
Scaffold
NC_012224.1
Start
72140
End
72253
Strand
+
Link
Genbank id:7564881
Molecular function
Cellular component
GO:0009512 | cytochrome b6f complex
Biological process
KEGG
Entry: K02640
Name: petG
Definition: cytochrome b6-f complex subunit 5
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGATTGAAGTTCTTCTATTTGGAATCGTCTTAGGTCTAATTCCTATTACTTTGGCCGGATTATTCGTAACTGCATATTTA CAATACAGACGTGGCGATCAATTGGACCTTTGAT
Gene structure

JCDB Genes gff download

JCDBG00059 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00059's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00059JCDBG00050co-exp0.913866
JCDBG00059JCDBG00062co-exp0.900039
JCDBG00059JCDBG00069co-exp0.875434
JCDBG00059JCDBG00028co-exp0.859519
JCDBG00059JCDBG00065co-exp0.854837
JCDBG00059JCDBG03523co-exp0.847038
JCDBG00059JCDBG00075co-exp0.844734
JCDBG00059JCDBG21443co-exp0.84234
JCDBG00059JCDBG00777co-exp0.839312
JCDBG00059JCDBG00037co-exp0.836578
JCDBG00050JCDBG00062co-exp0.929095
JCDBG00050JCDBG00069co-exp0.883856
JCDBG00050JCDBG00028co-exp0.913276
JCDBG00050JCDBG00065co-exp0.904811
JCDBG00050JCDBG03523co-exp0.859393
JCDBG00050JCDBG00075co-exp0.919816
JCDBG00050JCDBG21443co-exp0.849547
JCDBG00050JCDBG00777co-exp0.899601
JCDBG00050JCDBG00037co-exp0.895607
JCDBG00062JCDBG00069co-exp0.90278
JCDBG00062JCDBG00028co-exp0.880102
JCDBG00062JCDBG00065co-exp0.946062
JCDBG00062JCDBG03523co-exp0.874506
JCDBG00062JCDBG00075co-exp0.905767
JCDBG00062JCDBG21443co-exp0.8491
JCDBG00062JCDBG00777co-exp0.892505
JCDBG00062JCDBG00037co-exp0.934869
JCDBG00069JCDBG00028co-exp0.804045
JCDBG00069JCDBG00065co-exp0.883197
JCDBG00069JCDBG03523co-exp0.807095
JCDBG00069JCDBG00075co-exp0.910429
JCDBG00069JCDBG21443co-exp0.780885
JCDBG00069JCDBG00777co-exp0.846392
JCDBG00069JCDBG00037co-exp0.914379
JCDBG00028JCDBG00065co-exp0.836263
JCDBG00028JCDBG03523co-exp0.83086
JCDBG00028JCDBG00075co-exp0.851903
JCDBG00028JCDBG21443co-exp0.802791
JCDBG00028JCDBG00777co-exp0.825133
JCDBG00028JCDBG00037co-exp0.817444
JCDBG00065JCDBG03523co-exp0.868199
JCDBG00065JCDBG00075co-exp0.920844
JCDBG00065JCDBG21443co-exp0.841825
JCDBG00065JCDBG00777co-exp0.850414
JCDBG00065JCDBG00037co-exp0.962165
JCDBG03523JCDBG00075co-exp0.852507
JCDBG03523JCDBG21443co-exp0.868709
JCDBG03523JCDBG00777co-exp0.857546
JCDBG03523JCDBG00037co-exp0.849025
JCDBG00075JCDBG21443co-exp0.81471
JCDBG00075JCDBG00777co-exp0.900444
JCDBG00075JCDBG00037co-exp0.939222
JCDBG21443JCDBG00777co-exp0.851674
JCDBG21443JCDBG00037co-exp0.807638
JCDBG00777JCDBG00037co-exp0.859529
PPI network
node1node2type
JCDBR00059
ID
JCDBR00059
Name
petG
Type
protein_coding
Scaffold
NC_012224.1
Start
72140
End
72253
Strand
+
Exon
72140-72253
Sequence
TGATTGAAGTTCTTCTATTTGGAATCGTCTTAGGTCTAATTCCTATTACTTTGGCCGGATTATTCGTAACTGCATATTTA CAATACAGACGTGGCGATCAATTGGACCTTTGAT
Product
Source
RefSeq
Link:
JCDBP00039
ID
JCDBP00039
Parent
JCDBR00059
Name
YP_002720131.1
Scaffold
NC_012224.1
CDS
72140-72253
Strand:
+
Sequence
MIEVLLFGIVLGLIPITLAGLFVTAYLQYRRGDQLDL
Product
cytochrome b6/f complex subunit V
Source
RefSeq
Link
YP_002720131.1
InterProScan
IPR003683 Cytochrome b6/f complex, subunit 5
Pfam
PF02529.11 PetG Family