Detail information of JCDBG00062

JCDBG00062
ID
JCDBG00062
Name
psaJ
Type
protein_coding
Scaffold
NC_012224.1
Start
73101
End
73235
Strand
+
Link
Genbank id:7564754
Molecular function
Cellular component
GO:0009522 | photosystem I
Biological process
GO:0015979 | photosynthesis
KEGG
Entry: K02697
Name: psaJ
Definition: photosystem I subunit IX
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGCGAGATCTAAAAACATATCTATCGGTGGCACCGGTAATAAGTACTCTATGGTTTGGGTCTTTAGCAGGTCTATTGATA GAGATCAATCGTTTTTTCCCAGATGCGTTGACATTCCCCTTTTTTTCATTCTAGT
Gene structure

JCDB Genes gff download

JCDBG00062 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00062's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00062JCDBG00065co-exp0.946062
JCDBG00062JCDBG00037co-exp0.934869
JCDBG00062JCDBG00050co-exp0.929095
JCDBG00062JCDBG00063co-exp0.914786
JCDBG00062JCDBG00012co-exp0.910668
JCDBG00062JCDBG00046co-exp0.908979
JCDBG00062JCDBG00070co-exp0.90613
JCDBG00062JCDBG00075co-exp0.905767
JCDBG00062JCDBG00112co-exp0.902815
JCDBG00062JCDBG00069co-exp0.90278
JCDBG00065JCDBG00037co-exp0.962165
JCDBG00065JCDBG00050co-exp0.904811
JCDBG00065JCDBG00063co-exp0.942622
JCDBG00065JCDBG00012co-exp0.946607
JCDBG00065JCDBG00046co-exp0.954196
JCDBG00065JCDBG00070co-exp0.908277
JCDBG00065JCDBG00075co-exp0.920844
JCDBG00065JCDBG00112co-exp0.944148
JCDBG00065JCDBG00069co-exp0.883197
JCDBG00037JCDBG00050co-exp0.895607
JCDBG00037JCDBG00063co-exp0.966339
JCDBG00037JCDBG00012co-exp0.963833
JCDBG00037JCDBG00046co-exp0.956923
JCDBG00037JCDBG00070co-exp0.943138
JCDBG00037JCDBG00075co-exp0.939222
JCDBG00037JCDBG00112co-exp0.958141
JCDBG00037JCDBG00069co-exp0.914379
JCDBG00050JCDBG00063co-exp0.890308
JCDBG00050JCDBG00012co-exp0.866965
JCDBG00050JCDBG00046co-exp0.858844
JCDBG00050JCDBG00070co-exp0.868485
JCDBG00050JCDBG00075co-exp0.919816
JCDBG00050JCDBG00112co-exp0.875256
JCDBG00050JCDBG00069co-exp0.883856
JCDBG00063JCDBG00012co-exp0.938615
JCDBG00063JCDBG00046co-exp0.932346
JCDBG00063JCDBG00070co-exp0.952478
JCDBG00063JCDBG00075co-exp0.953019
JCDBG00063JCDBG00112co-exp0.929563
JCDBG00063JCDBG00069co-exp0.911133
JCDBG00012JCDBG00046co-exp0.949104
JCDBG00012JCDBG00070co-exp0.911621
JCDBG00012JCDBG00075co-exp0.912519
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG00069co-exp0.905684
JCDBG00046JCDBG00070co-exp0.918786
JCDBG00046JCDBG00075co-exp0.886163
JCDBG00046JCDBG00112co-exp0.924872
JCDBG00046JCDBG00069co-exp0.864569
JCDBG00070JCDBG00075co-exp0.901847
JCDBG00070JCDBG00112co-exp0.886046
JCDBG00070JCDBG00069co-exp0.930227
JCDBG00075JCDBG00112co-exp0.92744
JCDBG00075JCDBG00069co-exp0.910429
JCDBG00112JCDBG00069co-exp0.901977
PPI network
node1node2type
JCDBR00062
ID
JCDBR00062
Name
psaJ
Type
protein_coding
Scaffold
NC_012224.1
Start
73101
End
73235
Strand
+
Exon
73101-73235
Sequence
TGCGAGATCTAAAAACATATCTATCGGTGGCACCGGTAATAAGTACTCTATGGTTTGGGTCTTTAGCAGGTCTATTGATA GAGATCAATCGTTTTTTCCCAGATGCGTTGACATTCCCCTTTTTTTCATTCTAGT
Product
Source
RefSeq
Link:
JCDBP00040
ID
JCDBP00040
Parent
JCDBR00062
Name
YP_002720132.1
Scaffold
NC_012224.1
CDS
73101-73235
Strand:
+
Sequence
MRDLKTYLSVAPVISTLWFGSLAGLLIEINRFFPDALTFPFFSF
Product
photosystem I subunit IX
Source
RefSeq
Link
YP_002720132.1
InterProScan
IPR002615 Photosystem I PsaJ, reaction centre subunit IX
Pfam
PF01701.14 PSI_PsaJ Family