Detail information of JCDBG00063

JCDBG00063
ID
JCDBG00063
Name
rpl33
Type
protein_coding
Scaffold
NC_012224.1
Start
73694
End
73894
Strand
+
Link
Genbank id:7564755
Molecular function
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0005622 | intracellular
Biological process
GO:0006412 | translation
KEGG
Entry: K02913
Name: RP-L33, MRPL33, rpmG
Definition: large subunit ribosomal protein L33
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
TGGCCAAGGGTAAAGATGTCCGGGTAAGAGTTATTTTAGAATGTACCGGTTGTGTTCGAAACAGTGTTAATAAGAAATCA ACAGGCATTTCAAAATATATTACTCAAAAGAATCGACACAATACGCCTAGTCGATTGGAATTGAGAAAATTCTGTCCTTA TTGTTACAAACATACAATTCACGGGGAGATAAAGAAATAGA
Gene structure

JCDB Genes gff download

JCDBG00063 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00063's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00063JCDBG00037co-exp0.966339
JCDBG00063JCDBG00075co-exp0.953019
JCDBG00063JCDBG00070co-exp0.952478
JCDBG00063JCDBG11239co-exp0.950032
JCDBG00063JCDBG00065co-exp0.942622
JCDBG00063JCDBG03063co-exp0.941958
JCDBG00063JCDBG00012co-exp0.938615
JCDBG00063JCDBG00046co-exp0.932346
JCDBG00063JCDBG00112co-exp0.929563
JCDBG00063JCDBG07355co-exp0.927425
JCDBG00037JCDBG00075co-exp0.939222
JCDBG00037JCDBG00070co-exp0.943138
JCDBG00037JCDBG11239co-exp0.943379
JCDBG00037JCDBG00065co-exp0.962165
JCDBG00037JCDBG03063co-exp0.928898
JCDBG00037JCDBG00012co-exp0.963833
JCDBG00037JCDBG00046co-exp0.956923
JCDBG00037JCDBG00112co-exp0.958141
JCDBG00037JCDBG07355co-exp0.930475
JCDBG00075JCDBG00070co-exp0.901847
JCDBG00075JCDBG11239co-exp0.952265
JCDBG00075JCDBG00065co-exp0.920844
JCDBG00075JCDBG03063co-exp0.920301
JCDBG00075JCDBG00012co-exp0.912519
JCDBG00075JCDBG00046co-exp0.886163
JCDBG00075JCDBG00112co-exp0.92744
JCDBG00075JCDBG07355co-exp0.851933
JCDBG00070JCDBG11239co-exp0.898642
JCDBG00070JCDBG00065co-exp0.908277
JCDBG00070JCDBG03063co-exp0.890588
JCDBG00070JCDBG00012co-exp0.911621
JCDBG00070JCDBG00046co-exp0.918786
JCDBG00070JCDBG00112co-exp0.886046
JCDBG00070JCDBG07355co-exp0.909479
JCDBG11239JCDBG00065co-exp0.91345
JCDBG11239JCDBG03063co-exp0.947547
JCDBG11239JCDBG00012co-exp0.912939
JCDBG11239JCDBG00046co-exp0.899265
JCDBG11239JCDBG00112co-exp0.919971
JCDBG11239JCDBG07355co-exp0.874631
JCDBG00065JCDBG03063co-exp0.877953
JCDBG00065JCDBG00012co-exp0.946607
JCDBG00065JCDBG00046co-exp0.954196
JCDBG00065JCDBG00112co-exp0.944148
JCDBG00065JCDBG07355co-exp0.934898
JCDBG03063JCDBG00012co-exp0.903763
JCDBG03063JCDBG00046co-exp0.874556
JCDBG03063JCDBG00112co-exp0.896028
JCDBG03063JCDBG07355co-exp0.864936
JCDBG00012JCDBG00046co-exp0.949104
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG07355co-exp0.91033
JCDBG00046JCDBG00112co-exp0.924872
JCDBG00046JCDBG07355co-exp0.936736
JCDBG00112JCDBG07355co-exp0.887364
PPI network
node1node2type
JCDBR00063
ID
JCDBR00063
Name
rpl33
Type
protein_coding
Scaffold
NC_012224.1
Start
73694
End
73894
Strand
+
Exon
73694-73894
Sequence
TGGCCAAGGGTAAAGATGTCCGGGTAAGAGTTATTTTAGAATGTACCGGTTGTGTTCGAAACAGTGTTAATAAGAAATCA ACAGGCATTTCAAAATATATTACTCAAAAGAATCGACACAATACGCCTAGTCGATTGGAATTGAGAAAATTCTGTCCTTA TTGTTACAAACATACAATTCACGGGGAGATAAAGAAATAGA
Product
Source
RefSeq
Link:
JCDBP00041
ID
JCDBP00041
Parent
JCDBR00063
Name
YP_002720133.1
Scaffold
NC_012224.1
CDS
73694-73894
Strand:
+
Sequence
MAKGKDVRVRVILECTGCVRNSVNKKSTGISKYITQKNRHNTPSRLELRKFCPYCYKHTIHGEIKK
Product
rpl33
Source
RefSeq
Link
YP_002720133.1
InterProScan
IPR001705 Ribosomal protein L33
IPR011332 Zinc-binding ribosomal protein
IPR018264 Ribosomal protein L33, conserved site
Pfam
PF00471.16 Ribosomal_L33 Family