Detail information of JCDBG00064

JCDBG00064
ID
JCDBG00064
Name
rps18
Type
protein_coding
Scaffold
NC_012224.1
Start
74204
End
74530
Strand
+
Link
Genbank id:7564756 | Jatropha Genome Database ID:Jcr4U31589.20
Molecular function
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0005622 | intracellular
Biological process
GO:0006412 | translation
KEGG
Entry: K02963
Name: RP-S18, MRPS18, rpsR
Definition: small subunit ribosomal protein S18
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
TGGATAAATCCAAACGACTTTTTCTTAAGTCCAAGCGATCTTTTCGTAGGCGTTTGCCCCCGATCCAATCGGGGGATCGA ATTGATTATAGAAACATGAGTTTAATTAGTCGATTTATTAGTGAACAAGGAAAAATATTATCTAGACGGGTGAATAGATT GAGTTTAAAACAACAACGATTAATTACTATTGCTATAAAGCAAGCTCGTATTTTATCTTCGTTACCTTTTCTTAATAATG AAAAACAGTTTGAAAAAAGCGAGTTGGTCACTATAACTACTGATCTTAGAACCAGAAAAAAAAAAATAGACTTACTCCTC AATTGAA
Gene structure

JCDB Genes gff download

JCDBG00064 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00064's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00064JCDBG00043co-exp0.912455
JCDBG00064JCDBG00013co-exp0.907456
JCDBG00064JCDBG00020co-exp0.899486
JCDBG00064JCDBG00029co-exp0.87883
JCDBG00064JCDBG17813co-exp-0.814532
JCDBG00064JCDBG11103co-exp-0.80251
JCDBG00064JCDBG21498co-exp0.790602
JCDBG00064JCDBG00103co-exp0.789889
JCDBG00064JCDBG12963co-exp-0.787736
JCDBG00064JCDBG15157co-exp-0.786649
JCDBG00043JCDBG00013co-exp0.958265
JCDBG00043JCDBG00020co-exp0.888094
JCDBG00043JCDBG00029co-exp0.950823
JCDBG00043JCDBG17813co-exp-0.795074
JCDBG00043JCDBG11103co-exp-0.743975
JCDBG00043JCDBG21498co-exp0.75304
JCDBG00043JCDBG00103co-exp0.825906
JCDBG00043JCDBG12963co-exp-0.701159
JCDBG00043JCDBG15157co-exp-0.732343
JCDBG00013JCDBG00020co-exp0.882966
JCDBG00013JCDBG00029co-exp0.954387
JCDBG00013JCDBG17813co-exp-0.816654
JCDBG00013JCDBG11103co-exp-0.774247
JCDBG00013JCDBG21498co-exp0.784049
JCDBG00013JCDBG00103co-exp0.758222
JCDBG00013JCDBG12963co-exp-0.725258
JCDBG00013JCDBG15157co-exp-0.748447
JCDBG00020JCDBG00029co-exp0.868454
JCDBG00020JCDBG17813co-exp-0.793444
JCDBG00020JCDBG11103co-exp-0.775505
JCDBG00020JCDBG21498co-exp0.777853
JCDBG00020JCDBG00103co-exp0.756766
JCDBG00020JCDBG12963co-exp-0.806032
JCDBG00020JCDBG15157co-exp-0.773596
JCDBG00029JCDBG17813co-exp-0.787629
JCDBG00029JCDBG11103co-exp-0.733313
JCDBG00029JCDBG21498co-exp0.693911
JCDBG00029JCDBG00103co-exp0.772204
JCDBG00029JCDBG12963co-exp-0.657239
JCDBG00029JCDBG15157co-exp-0.704669
JCDBG17813JCDBG11103co-exp0.799068
JCDBG17813JCDBG21498co-exp-0.725126
JCDBG17813JCDBG00103co-exp-0.605758
JCDBG17813JCDBG12963co-exp0.754362
JCDBG17813JCDBG15157co-exp0.858679
JCDBG11103JCDBG21498co-exp-0.72959
JCDBG11103JCDBG12963co-exp0.755093
JCDBG11103JCDBG15157co-exp0.733818
JCDBG21498JCDBG12963co-exp-0.783137
JCDBG21498JCDBG15157co-exp-0.792166
JCDBG12963JCDBG15157co-exp0.819891
PPI network
node1node2type
JCDBR00064
ID
JCDBR00064
Name
rps18
Type
protein_coding
Scaffold
NC_012224.1
Start
74204
End
74530
Strand
+
Exon
74204-74530
Sequence
TGGATAAATCCAAACGACTTTTTCTTAAGTCCAAGCGATCTTTTCGTAGGCGTTTGCCCCCGATCCAATCGGGGGATCGA ATTGATTATAGAAACATGAGTTTAATTAGTCGATTTATTAGTGAACAAGGAAAAATATTATCTAGACGGGTGAATAGATT GAGTTTAAAACAACAACGATTAATTACTATTGCTATAAAGCAAGCTCGTATTTTATCTTCGTTACCTTTTCTTAATAATG AAAAACAGTTTGAAAAAAGCGAGTTGGTCACTATAACTACTGATCTTAGAACCAGAAAAAAAAAAATAGACTTACTCCTC AATTGAA
Product
Source
RefSeq
Link:
JCDBP00042
ID
JCDBP00042
Parent
JCDBR00064
Name
YP_002720134.1
Scaffold
NC_012224.1
CDS
74204-74530
Strand:
+
Sequence
MDKSKRLFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLSLKQQRLITIAIKQARILSSLPFLNN EKQFEKSELVTITTDLRTRKKKIDLLLN
Product
ribosomal protein S18
Source
RefSeq
Link
YP_002720134.1
InterProScan
IPR001648 Ribosomal protein S18
IPR018275 Ribosomal protein S18, conserved site
Pfam
PF01084.16 Ribosomal_S18 Family