Detail information of JCDBG00065

JCDBG00065
ID
JCDBG00065
Name
rpl20
Type
protein_coding
Scaffold
NC_012224.1
Start
74821
End
75174
Strand
-
Link
Genbank id:7564757
Molecular function
GO:0003735 | structural constituent of ribosome
GO:0019843 | rRNA binding
Cellular component
GO:0005840 | ribosome
GO:0005622 | intracellular
Biological process
GO:0006412 | translation
KEGG
Entry: K02887
Name: RP-L20, MRPL20, rplT
Definition: large subunit ribosomal protein L20
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
AATGACCAGAATTAGACGAGGATATATAGCTCGGAGGCGTAGAACAAAAATTCGTTTATTTGCATCAAGCTTTCGCGGGG CTCATTCAAGACTTACTCGAACTATTATTCAACAAAAAATAAGAGCTTTGATTTCGGCCCATCGGGATAGAGATAGGCAA AAAGGAAATTTTCGTCGTTTGTGGGTCACTCGGATAAATGCAGCAATTCGCGAGAATAAGGTATCCAAAAGTTATAGTAG ATTAATAAACAATCTGTACAAGAGACAGTTGCTTCTTAATCGTAAAATACTTGCACAAATCGCTATAGTAAATAAGAATT GTCTTTATATGATTGCCAATGACATTATAAAATA
Gene structure

JCDB Genes gff download

JCDBG00065 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00065's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00065JCDBG00037co-exp0.962165
JCDBG00065JCDBG00046co-exp0.954196
JCDBG00065JCDBG00012co-exp0.946607
JCDBG00065JCDBG00062co-exp0.946062
JCDBG00065JCDBG00112co-exp0.944148
JCDBG00065JCDBG00063co-exp0.942622
JCDBG00065JCDBG07355co-exp0.934898
JCDBG00065JCDBG13737co-exp0.92939
JCDBG00065JCDBG16110co-exp0.921723
JCDBG00065JCDBG00075co-exp0.920844
JCDBG00037JCDBG00046co-exp0.956923
JCDBG00037JCDBG00012co-exp0.963833
JCDBG00037JCDBG00062co-exp0.934869
JCDBG00037JCDBG00112co-exp0.958141
JCDBG00037JCDBG00063co-exp0.966339
JCDBG00037JCDBG07355co-exp0.930475
JCDBG00037JCDBG13737co-exp0.912383
JCDBG00037JCDBG16110co-exp0.903701
JCDBG00037JCDBG00075co-exp0.939222
JCDBG00046JCDBG00012co-exp0.949104
JCDBG00046JCDBG00062co-exp0.908979
JCDBG00046JCDBG00112co-exp0.924872
JCDBG00046JCDBG00063co-exp0.932346
JCDBG00046JCDBG07355co-exp0.936736
JCDBG00046JCDBG13737co-exp0.894468
JCDBG00046JCDBG16110co-exp0.887913
JCDBG00046JCDBG00075co-exp0.886163
JCDBG00012JCDBG00062co-exp0.910668
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG00063co-exp0.938615
JCDBG00012JCDBG07355co-exp0.91033
JCDBG00012JCDBG13737co-exp0.892212
JCDBG00012JCDBG16110co-exp0.886207
JCDBG00012JCDBG00075co-exp0.912519
JCDBG00062JCDBG00112co-exp0.902815
JCDBG00062JCDBG00063co-exp0.914786
JCDBG00062JCDBG07355co-exp0.891163
JCDBG00062JCDBG13737co-exp0.899092
JCDBG00062JCDBG16110co-exp0.887449
JCDBG00062JCDBG00075co-exp0.905767
JCDBG00112JCDBG00063co-exp0.929563
JCDBG00112JCDBG07355co-exp0.887364
JCDBG00112JCDBG13737co-exp0.892498
JCDBG00112JCDBG16110co-exp0.89368
JCDBG00112JCDBG00075co-exp0.92744
JCDBG00063JCDBG07355co-exp0.927425
JCDBG00063JCDBG13737co-exp0.885057
JCDBG00063JCDBG16110co-exp0.868713
JCDBG00063JCDBG00075co-exp0.953019
JCDBG07355JCDBG13737co-exp0.899935
JCDBG07355JCDBG16110co-exp0.861811
JCDBG07355JCDBG00075co-exp0.851933
JCDBG13737JCDBG16110co-exp0.939132
JCDBG13737JCDBG00075co-exp0.875685
JCDBG16110JCDBG00075co-exp0.905513
PPI network
node1node2type
JCDBR00065
ID
JCDBR00065
Name
rpl20
Type
protein_coding
Scaffold
NC_012224.1
Start
74821
End
75174
Strand
-
Exon
74821-75174
Sequence
AATGACCAGAATTAGACGAGGATATATAGCTCGGAGGCGTAGAACAAAAATTCGTTTATTTGCATCAAGCTTTCGCGGGG CTCATTCAAGACTTACTCGAACTATTATTCAACAAAAAATAAGAGCTTTGATTTCGGCCCATCGGGATAGAGATAGGCAA AAAGGAAATTTTCGTCGTTTGTGGGTCACTCGGATAAATGCAGCAATTCGCGAGAATAAGGTATCCAAAAGTTATAGTAG ATTAATAAACAATCTGTACAAGAGACAGTTGCTTCTTAATCGTAAAATACTTGCACAAATCGCTATAGTAAATAAGAATT GTCTTTATATGATTGCCAATGACATTATAAAATA
Product
Source
RefSeq
Link:
JCDBP00043
ID
JCDBP00043
Parent
JCDBR00065
Name
YP_002720135.1
Scaffold
NC_012224.1
CDS
74821-75174
Strand:
-
Sequence
MTRIRRGYIARRRRTKIRLFASSFRGAHSRLTRTIIQQKIRALISAHRDRDRQKGNFRRLWVTRINAAIRENKVSKSYSR LINNLYKRQLLLNRKILAQIAIVNKNCLYMIANDIIK
Product
ribosomal protein L20
Source
RefSeq
Link
YP_002720135.1
InterProScan
IPR005813 Ribosomal protein L20
Pfam
PF00453.14 Ribosomal_L20 Family