Detail information of JCDBG00066

JCDBG00066
ID
JCDBG00066
Name
clpP
Type
protein_coding
Scaffold
NC_012224.1
Start
76291
End
78397
Strand
-
Link
Genbank id:7564759
Molecular function
GO:0004252 | serine-type endopeptidase activity
Cellular component
Biological process
GO:0006508 | proteolysis
KEGG
Entry: K01358
Name: clpP, CLPP
Definition: ATP-dependent Clp protease, protease subunit [EC:3.4.21.92]
ko04112:   Cell cycle - Caulobacter
ko04212:   Longevity regulating pathway - worm
Source
RefSeq
TF
Description
Sequence
AATGCCTATTGGTGTTCCAAAAGTCCCTTTTCGAAATCCTGGGGAAGACGATTCAATTTGGATTGACGTATAGTGCGACT TGTCAGATATATTGGGTCATACGGGATTCCCCCGTTCTCTCCCCTGATTGAGATATCCTCTGTTTCGCCCAAGAAAGATT GATTAAATCATCCAAAATTTGGAGCGTGAAGTGCAATGAAGTCCAATTAGATCTATGCTTTTGAGGTACCCAGATTAGTA TTATCAATTAGAATAATTTATGGTTGGCTTGTATGGACAAAAAAAATGAAGTATCCAGGCTCCGTTTAGAAAACCCAATT GGTAATATATCTATTATGATTACTACTTTTATCATATTCTTTCTATTTATAAATTAGGAATAATTGCAAACTGCTAATCA TATTCAACCGAATAATAAAATGAAAAATGAATACGTCAAATATTTGGCAGAAGACGTGAAATCAATTAGGAATTAAATAA AAAAAAGAAGTTATAACAAAAGAAAAAGACGCGGTATTGGGGCATTTGCCCTATATGTGCAAATAAAAATCGGGCAGATC TTTACTCGGAGTAGAGCACAAACCTAAAAAAATGGAAGAAGCCCATTCAGGAACAAGAAAATGCCATCGTGATTTGAGTT GAATCTCGATGAAAGAATACATCAATGAGAAGTTTGTTTGATAAGTTTAATGCATTTTTTTTTTATAGGTAAACACGTCA AAACTCATCTTTCTTGAAAAATGGAAGGAAAGCCCCTTTATTAAAATTAGATTAGAATTAGAATAAAAAAGTGAAAAAGT ACTCACTATCAAACTATCAAAAAAAGGAGGGCTGGAATCTACACATTGATTCTTTTTTATTTTCGCAATTTGTGTTGAAC CGTATGCATCAAAAGGCGCATGTACGGTTTCTAGAGGATAGAATTTTATCCTAATCAACCGACTTTATCGAGAAAGATTA CTTTTTTTAGGTCAAGATGTTGATAGCGAAATCTCGAATCAACTTATTGGTCTTATGGTATATCTCAGTATAGAGAGCGA GACAAAAGATTTGTATTTGTTTATAAACTCTCCTGGCGGATGGGTAATACCCGGAATAGCTATTTATGATACTATGCAAT TTGTGCGACCAGATGTACAAACAGTATGCATGGGATTAGCTGCTTCAATGGGATCTTTTATCCTGGTCGGAGGAAAAATT ACCAAACGTTTAGCATTCCCTCATGCTTGGCGCCAATGGGTTTTTATTTGAATATTTTTAAAAGAAAAAGGAAAAGTATG CCTTCGCCATATGAAATATAATATAAAAATTAAGTAATAATAGCATGGCATTTCGAATTCGATATAAGAACAGTTTTTTA TTTTTTTTTAACATTAGATTATGTATCGAAAGAGTAGTATGAGATATTAAGGTAAGGGTATTTCTGATTTTATTCTATCA GGGGCCTATTTCAGCGTCACAAACTTTTCTGTTTTCGCACTTCGGGGCTCTTAACACTATTTATGTTATGAAAGAGTACA AAAAAGATTATATTATTTTCTTTTTTTTCAAATAAAAACAAAAAAGAAACTTTGGGATTGCTAAATCACTGATGAAAAAA AGCAACGGGACCACCATAGTATTTTTGTTTTTTAACTCCTCCCAAGGAAAGGGTGGTTATTGAATCATTTACTGATTTAA GCCTGATAAACTCTAAATTTTTCTTCGATGAAAGGTAAAAGCGAATTCTATTGTGGAGCCGTATGCAATGCACAAAAAAT GCCTGTACGGTTGTTCAATTCTATCTTTTTTCTTATTATTCTTTATCTCTTCTCGTCATCTTATTTTTTTTATGTATTAT GTTATGCAAGATAGAATAACCATTTTCTTCTTATATCATCAGGGTAATGATTCATCAACCTATTGCTGGTTTTTATGAGG CACAAATAGTAGAATTTGTCCTGGAAGCAGAAGAACTACTGAAACTGCGCGAAATCCTCACAAGGATTTATGCACAAAGA ACGGGAAAACCCTTATGGATTGTATCCGAAGACATGGAAAGAGATGTTTTTATGTCAGCAACAGAAGCCCAAGCTCATGG AATTGTTGACCTTGTAGCAGTTGCCTA
Gene structure

JCDB Genes gff download

JCDBG00066 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00066's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00066JCDBG00017co-exp0.924073
JCDBG00066JCDBG00014co-exp0.856988
JCDBG00066JCDBG00015co-exp0.817076
JCDBG00066JCDBG00016co-exp0.814743
JCDBG00066JCDBG00074co-exp0.812118
JCDBG00066JCDBG00043co-exp0.801506
JCDBG00066JCDBG00103co-exp0.80025
JCDBG00066JCDBG00076co-exp0.790643
JCDBG00066JCDBG00013co-exp0.788828
JCDBG00066JCDBG00064co-exp0.767701
JCDBG00017JCDBG00014co-exp0.844381
JCDBG00017JCDBG00015co-exp0.837062
JCDBG00017JCDBG00016co-exp0.87755
JCDBG00017JCDBG00074co-exp0.864342
JCDBG00017JCDBG00043co-exp0.710908
JCDBG00017JCDBG00103co-exp0.787108
JCDBG00017JCDBG00076co-exp0.827276
JCDBG00017JCDBG00013co-exp0.679238
JCDBG00017JCDBG00064co-exp0.679246
JCDBG00014JCDBG00015co-exp0.962428
JCDBG00014JCDBG00016co-exp0.880861
JCDBG00014JCDBG00074co-exp0.908064
JCDBG00014JCDBG00043co-exp0.885746
JCDBG00014JCDBG00103co-exp0.803491
JCDBG00014JCDBG00076co-exp0.927644
JCDBG00014JCDBG00013co-exp0.863631
JCDBG00014JCDBG00064co-exp0.756636
JCDBG00015JCDBG00016co-exp0.940419
JCDBG00015JCDBG00074co-exp0.915663
JCDBG00015JCDBG00043co-exp0.838211
JCDBG00015JCDBG00103co-exp0.826044
JCDBG00015JCDBG00076co-exp0.930852
JCDBG00015JCDBG00013co-exp0.801903
JCDBG00015JCDBG00064co-exp0.698302
JCDBG00016JCDBG00074co-exp0.898756
JCDBG00016JCDBG00043co-exp0.685365
JCDBG00016JCDBG00103co-exp0.779471
JCDBG00016JCDBG00076co-exp0.885852
JCDBG00016JCDBG00013co-exp0.652062
JCDBG00074JCDBG00043co-exp0.72181
JCDBG00074JCDBG00103co-exp0.74983
JCDBG00074JCDBG00076co-exp0.954077
JCDBG00074JCDBG00013co-exp0.710655
JCDBG00074JCDBG00064co-exp0.632604
JCDBG00043JCDBG00103co-exp0.825906
JCDBG00043JCDBG00076co-exp0.777139
JCDBG00043JCDBG00013co-exp0.958265
JCDBG00043JCDBG00064co-exp0.912455
JCDBG00103JCDBG00076co-exp0.754901
JCDBG00103JCDBG00013co-exp0.758222
JCDBG00103JCDBG00064co-exp0.789889
JCDBG00076JCDBG00013co-exp0.754789
JCDBG00076JCDBG00064co-exp0.667081
JCDBG00013JCDBG00064co-exp0.907456
PPI network
node1node2type
JCDBG00066JCDBG23264PPI
JCDBG00066JCDBG07310PPI
JCDBG00066JCDBG22873PPI
JCDBG00066JCDBG00839PPI
JCDBG00066JCDBG07648PPI
JCDBG00066JCDBG20730PPI
JCDBG00066JCDBG22216PPI
JCDBG00066JCDBG17510PPI
JCDBG00066JCDBG20734PPI
JCDBG00066JCDBG02742PPI
JCDBG23264JCDBG20730PPI
JCDBG07310JCDBG22216PPI
JCDBG22873JCDBG22216PPI
JCDBG22873JCDBG17510PPI
JCDBG00839JCDBG22216PPI
JCDBG00839JCDBG02742PPI
JCDBG07648JCDBG22216PPI
JCDBG07648JCDBG20734PPI
JCDBG22216JCDBG17510PPI
JCDBG22216JCDBG20734PPI
JCDBG22216JCDBG02742PPI
JCDBR00066
ID
JCDBR00066
Name
clpP
Type
protein_coding
Scaffold
NC_012224.1
Start
76291
End
78397
Strand
-
Exon
76291-76518,77172-77462,78329-78397
Sequence
AATGCCTATTGGTGTTCCAAAAGTCCCTTTTCGAAATCCTGGGGAAGACGATTCAATTTGGATTGACGTATAGTGCGACT TGTCAGATATATTGGGTCATACGGGATTCCCCCGTTCTCTCCCCTGATTGAGATATCCTCTGTTTCGCCCAAGAAAGATT GATTAAATCATCCAAAATTTGGAGCGTGAAGTGCAATGAAGTCCAATTAGATCTATGCTTTTGAGGTACCCAGATTAGTA TTATCAATTAGAATAATTTATGGTTGGCTTGTATGGACAAAAAAAATGAAGTATCCAGGCTCCGTTTAGAAAACCCAATT GGTAATATATCTATTATGATTACTACTTTTATCATATTCTTTCTATTTATAAATTAGGAATAATTGCAAACTGCTAATCA TATTCAACCGAATAATAAAATGAAAAATGAATACGTCAAATATTTGGCAGAAGACGTGAAATCAATTAGGAATTAAATAA AAAAAAGAAGTTATAACAAAAGAAAAAGACGCGGTATTGGGGCATTTGCCCTATATGTGCAAATAAAAATCGGGCAGATC TTTACTCGGAGTAGAGCACAAACCTAAAAAAATGGAAGAAGCCCATTCAGGAACAAGAAAATGCCATCGTGATTTGAGTT GAATCTCGATGAAAGAATACATCAATGAGAAGTTTGTTTGATAAGTTTAATGCATTTTTTTTTTATAGGTAAACACGTCA AAACTCATCTTTCTTGAAAAATGGAAGGAAAGCCCCTTTATTAAAATTAGATTAGAATTAGAATAAAAAAGTGAAAAAGT ACTCACTATCAAACTATCAAAAAAAGGAGGGCTGGAATCTACACATTGATTCTTTTTTATTTTCGCAATTTGTGTTGAAC CGTATGCATCAAAAGGCGCATGTACGGTTTCTAGAGGATAGAATTTTATCCTAATCAACCGACTTTATCGAGAAAGATTA CTTTTTTTAGGTCAAGATGTTGATAGCGAAATCTCGAATCAACTTATTGGTCTTATGGTATATCTCAGTATAGAGAGCGA GACAAAAGATTTGTATTTGTTTATAAACTCTCCTGGCGGATGGGTAATACCCGGAATAGCTATTTATGATACTATGCAAT TTGTGCGACCAGATGTACAAACAGTATGCATGGGATTAGCTGCTTCAATGGGATCTTTTATCCTGGTCGGAGGAAAAATT ACCAAACGTTTAGCATTCCCTCATGCTTGGCGCCAATGGGTTTTTATTTGAATATTTTTAAAAGAAAAAGGAAAAGTATG CCTTCGCCATATGAAATATAATATAAAAATTAAGTAATAATAGCATGGCATTTCGAATTCGATATAAGAACAGTTTTTTA TTTTTTTTTAACATTAGATTATGTATCGAAAGAGTAGTATGAGATATTAAGGTAAGGGTATTTCTGATTTTATTCTATCA GGGGCCTATTTCAGCGTCACAAACTTTTCTGTTTTCGCACTTCGGGGCTCTTAACACTATTTATGTTATGAAAGAGTACA AAAAAGATTATATTATTTTCTTTTTTTTCAAATAAAAACAAAAAAGAAACTTTGGGATTGCTAAATCACTGATGAAAAAA AGCAACGGGACCACCATAGTATTTTTGTTTTTTAACTCCTCCCAAGGAAAGGGTGGTTATTGAATCATTTACTGATTTAA GCCTGATAAACTCTAAATTTTTCTTCGATGAAAGGTAAAAGCGAATTCTATTGTGGAGCCGTATGCAATGCACAAAAAAT GCCTGTACGGTTGTTCAATTCTATCTTTTTTCTTATTATTCTTTATCTCTTCTCGTCATCTTATTTTTTTTATGTATTAT GTTATGCAAGATAGAATAACCATTTTCTTCTTATATCATCAGGGTAATGATTCATCAACCTATTGCTGGTTTTTATGAGG CACAAATAGTAGAATTTGTCCTGGAAGCAGAAGAACTACTGAAACTGCGCGAAATCCTCACAAGGATTTATGCACAAAGA ACGGGAAAACCCTTATGGATTGTATCCGAAGACATGGAAAGAGATGTTTTTATGTCAGCAACAGAAGCCCAAGCTCATGG AATTGTTGACCTTGTAGCAGTTGCCTA
Product
Source
RefSeq
Link:
JCDBP00044
ID
JCDBP00044
Parent
JCDBR00066
Name
YP_002720137.1
Scaffold
NC_012224.1
CDS
76291-76518,77172-77462,78329-78397
Strand:
-
Sequence
MPIGVPKVPFRNPGEDDSIWIDVNRLYRERLLFLGQDVDSEISNQLIGLMVYLSIESETKDLYLFINSPGGWVIPGIAIY DTMQFVRPDVQTVCMGLAASMGSFILVGGKITKRLAFPHARVMIHQPIAGFYEAQIVEFVLEAEELLKLREILTRIYAQR TGKPLWIVSEDMERDVFMSATEAQAHGIVDLVAVA
Product
ATP-dependent Clp protease proteolytic subunit
Source
RefSeq
Link
YP_002720137.1
InterProScan
IPR001907 ATP-dependent Clp protease proteolytic subunit
IPR018215 ClpP, Ser active site
IPR023562 Clp protease proteolytic subunit /Translocation-enhancing protein TepA
IPR029045 ClpP/crotonase-like domain
IPR033135 ClpP, histidine active site
Pfam
PF00574.19 CLP_protease Domain