Detail information of JCDBG00067

JCDBG00067
ID
JCDBG00067
Name
psbB
Type
protein_coding
Scaffold
NC_012224.1
Start
78922
End
80448
Strand
+
Link
Genbank id:7564760
Molecular function
GO:0045156 | electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0016168 | chlorophyll binding
Cellular component
GO:0016020 | membrane
GO:0009521 | photosystem
GO:0009523 | photosystem II
Biological process
GO:0009772 | photosynthetic electron transport in photosystem II
GO:0019684 | photosynthesis, light reaction
GO:0009767 | photosynthetic electron transport chain
GO:0015979 | photosynthesis
KEGG
Entry: K02704
Name: psbB
Definition: photosystem II CP47 chlorophyll apoprotein
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGGGTTTGCCTTGGTATCGTGTTCATACCGTCGTATTGAATGATCCCGGTCGTTTGCTGTCTGTCCATATAATGCATACA GCCTTGGTTGCTGGTTGGGCCGGTTCGATGGCTCTATATGAATTAGCAGTTTTTGATCCCTCTGACCCCGTTCTCGATCC AATGTGGAGACAGGGTATGTTCGTTATACCCTTCATGACTCGTTTAGGAATAACCAATTCGTGGGGTGGTTGGAGTATCA CAGGAGGAACTATAACGAATCCGGGTATTTGGAGTTATGAAGGTGTGGCTGGGGCGCATATTGTGTTTTCTGGCTTGTGC TTTTTGGCAGCTATTTGGCATTGGGTGTATTGGGATCTAGAGGTATTTTGCGATGAACGTACAGGAAAACCTTCTTTAGA TTTGCCCAAGATCTTTGGAATTCATTTATTTCTCTCAGGAGTGGCTTGCTTTGGGTTTGGTGCTTTTCATGTAACCGGAT TGTATGGTCCTGGAATATGGGTGTCCGATCCTTATGGACTAACAGGAAAGGTACAACCTGTAAGTCCAGCATGGGGTGTG GAAGGTTTTGATCCTTTTGTTCCAGGAGGAATAGCTTCTCATCATATTGCAGCGGGGACATTGGGCATATTAGCGGGCCT CTTCCATCTTAGTGTCCGTCCGCCCCAACGTTTATACAAAGGATTGCGTATGGGAAATATTGAAACTGTCCTTTCCAGTA GTATCGCTGCTGTCTTTTTTGCAGCTTTTGTTGTTGCTGGAACTATGTGGTATGGTTCAGCAACTACCCCGATTGAATTA TTTGGTCCTACTCGTTATCAATGGGATCAAGGATACTTCCAGCAAGAAATATATCGAAGAGTTAGTGCTGGGCTAGCCGA AAATCAAAGTTTATCCGAAGCTTGGTCTAAAATTCCCGAAAAATTAGCCTTTTATGATTACATCGGCAATAATCCGGCAA AAGGTGGATTGTTCAGAGCAGGCTCAATGGACAACGGGGATGGAATAGCTGTTGGGTGGTTAGGACATCCTATCTTTAGA GATAAAGAAGGGCGTGAACTTTTTGTACGGCGTATGCCTACTTTTTTTGAAACATTTCCTGTTGTTTTGGTAGATGGAGA TGGAATTGTTAGAGCCGATGTTCCTTTTCGAAGGGCAGAGTCAAAGTATAGTGTCGAACAAGTAGGTGTAACTGTTGAGT TCTATGGTGGCGAACTAAACGGAGTCAGTTATAGTGATCCTGCTACTGTGAAAAAATATGCTAGACGCGCTCAATTGGGT GAAATTTTTGAATTAGATCGTGCTACTTTGAAATCTGATGGTGTTTTTCGTAGCAGTCCAAGGGGTTGGTTTACTTTTGG ACATGCTTCGTTTGCTCTGCTCTTTTTCTTCGGACACATTTGGCACGGTGCTCGAACTTTGTTCAGAGATGTTTTTGCTG GTATTGATCCAGATTTAGACGCTCAAGTGGAATTTGGAGCATTCCAAAAACTTGGAGATCCAACTACAAGAAGACAAGTA GTCTGAT
Gene structure

JCDB Genes gff download

JCDBG00067 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00067's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00067JCDBG00027co-exp0.928913
JCDBG00067JCDBG00047co-exp0.923353
JCDBG00067JCDBG00071co-exp0.921919
JCDBG00067JCDBG00026co-exp0.902249
JCDBG00067JCDBG00042co-exp0.900122
JCDBG00067JCDBG00033co-exp0.87946
JCDBG00067JCDBG00072co-exp0.876583
JCDBG00067JCDBG00002co-exp0.859833
JCDBG00067JCDBG04383co-exp0.858841
JCDBG00067JCDBG00034co-exp0.84116
JCDBG00027JCDBG00047co-exp0.913089
JCDBG00027JCDBG00071co-exp0.925427
JCDBG00027JCDBG00026co-exp0.967986
JCDBG00027JCDBG00042co-exp0.810646
JCDBG00027JCDBG00033co-exp0.935167
JCDBG00027JCDBG00072co-exp0.834429
JCDBG00027JCDBG00002co-exp0.921385
JCDBG00027JCDBG04383co-exp0.846182
JCDBG00027JCDBG00034co-exp0.884364
JCDBG00047JCDBG00071co-exp0.937953
JCDBG00047JCDBG00026co-exp0.916383
JCDBG00047JCDBG00042co-exp0.899261
JCDBG00047JCDBG00033co-exp0.885043
JCDBG00047JCDBG00072co-exp0.861011
JCDBG00047JCDBG00002co-exp0.867959
JCDBG00047JCDBG04383co-exp0.753862
JCDBG00047JCDBG00034co-exp0.836956
JCDBG00071JCDBG00026co-exp0.934561
JCDBG00071JCDBG00042co-exp0.860909
JCDBG00071JCDBG00033co-exp0.899852
JCDBG00071JCDBG00072co-exp0.850068
JCDBG00071JCDBG00002co-exp0.893332
JCDBG00071JCDBG04383co-exp0.773628
JCDBG00071JCDBG00034co-exp0.815403
JCDBG00026JCDBG00042co-exp0.811813
JCDBG00026JCDBG00033co-exp0.950075
JCDBG00026JCDBG00072co-exp0.818663
JCDBG00026JCDBG00002co-exp0.926188
JCDBG00026JCDBG04383co-exp0.805053
JCDBG00026JCDBG00034co-exp0.863772
JCDBG00042JCDBG00033co-exp0.779329
JCDBG00042JCDBG00072co-exp0.888954
JCDBG00042JCDBG00002co-exp0.746694
JCDBG00042JCDBG04383co-exp0.686202
JCDBG00042JCDBG00034co-exp0.778555
JCDBG00033JCDBG00072co-exp0.825452
JCDBG00033JCDBG00002co-exp0.899406
JCDBG00033JCDBG04383co-exp0.835816
JCDBG00033JCDBG00034co-exp0.902027
JCDBG00072JCDBG00002co-exp0.717616
JCDBG00072JCDBG04383co-exp0.750721
JCDBG00072JCDBG00034co-exp0.849769
JCDBG00002JCDBG04383co-exp0.788981
JCDBG00002JCDBG00034co-exp0.816051
JCDBG04383JCDBG00034co-exp0.761426
PPI network
node1node2type
JCDBR00067
ID
JCDBR00067
Name
psbB
Type
protein_coding
Scaffold
NC_012224.1
Start
78922
End
80448
Strand
+
Exon
78922-80448
Sequence
TGGGTTTGCCTTGGTATCGTGTTCATACCGTCGTATTGAATGATCCCGGTCGTTTGCTGTCTGTCCATATAATGCATACA GCCTTGGTTGCTGGTTGGGCCGGTTCGATGGCTCTATATGAATTAGCAGTTTTTGATCCCTCTGACCCCGTTCTCGATCC AATGTGGAGACAGGGTATGTTCGTTATACCCTTCATGACTCGTTTAGGAATAACCAATTCGTGGGGTGGTTGGAGTATCA CAGGAGGAACTATAACGAATCCGGGTATTTGGAGTTATGAAGGTGTGGCTGGGGCGCATATTGTGTTTTCTGGCTTGTGC TTTTTGGCAGCTATTTGGCATTGGGTGTATTGGGATCTAGAGGTATTTTGCGATGAACGTACAGGAAAACCTTCTTTAGA TTTGCCCAAGATCTTTGGAATTCATTTATTTCTCTCAGGAGTGGCTTGCTTTGGGTTTGGTGCTTTTCATGTAACCGGAT TGTATGGTCCTGGAATATGGGTGTCCGATCCTTATGGACTAACAGGAAAGGTACAACCTGTAAGTCCAGCATGGGGTGTG GAAGGTTTTGATCCTTTTGTTCCAGGAGGAATAGCTTCTCATCATATTGCAGCGGGGACATTGGGCATATTAGCGGGCCT CTTCCATCTTAGTGTCCGTCCGCCCCAACGTTTATACAAAGGATTGCGTATGGGAAATATTGAAACTGTCCTTTCCAGTA GTATCGCTGCTGTCTTTTTTGCAGCTTTTGTTGTTGCTGGAACTATGTGGTATGGTTCAGCAACTACCCCGATTGAATTA TTTGGTCCTACTCGTTATCAATGGGATCAAGGATACTTCCAGCAAGAAATATATCGAAGAGTTAGTGCTGGGCTAGCCGA AAATCAAAGTTTATCCGAAGCTTGGTCTAAAATTCCCGAAAAATTAGCCTTTTATGATTACATCGGCAATAATCCGGCAA AAGGTGGATTGTTCAGAGCAGGCTCAATGGACAACGGGGATGGAATAGCTGTTGGGTGGTTAGGACATCCTATCTTTAGA GATAAAGAAGGGCGTGAACTTTTTGTACGGCGTATGCCTACTTTTTTTGAAACATTTCCTGTTGTTTTGGTAGATGGAGA TGGAATTGTTAGAGCCGATGTTCCTTTTCGAAGGGCAGAGTCAAAGTATAGTGTCGAACAAGTAGGTGTAACTGTTGAGT TCTATGGTGGCGAACTAAACGGAGTCAGTTATAGTGATCCTGCTACTGTGAAAAAATATGCTAGACGCGCTCAATTGGGT GAAATTTTTGAATTAGATCGTGCTACTTTGAAATCTGATGGTGTTTTTCGTAGCAGTCCAAGGGGTTGGTTTACTTTTGG ACATGCTTCGTTTGCTCTGCTCTTTTTCTTCGGACACATTTGGCACGGTGCTCGAACTTTGTTCAGAGATGTTTTTGCTG GTATTGATCCAGATTTAGACGCTCAAGTGGAATTTGGAGCATTCCAAAAACTTGGAGATCCAACTACAAGAAGACAAGTA GTCTGAT
Product
Source
RefSeq
Link:
JCDBP00045
ID
JCDBP00045
Parent
JCDBR00067
Name
YP_002720138.1
Scaffold
NC_012224.1
CDS
78922-80448
Strand:
+
Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWSI TGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEVFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTG LYGPGIWVSDPYGLTGKVQPVSPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSEAWSKIPEKLAFYDYIGNNPA KGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVE FYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Product
photosystem II 47 kDa protein
Source
RefSeq
Link
YP_002720138.1
InterProScan
IPR000932 Photosystem antenna protein-like
IPR017486 Photosystem II CP47 reaction centre protein
Pfam
PF00421.15 PSII Family