Detail information of JCDBG00068

JCDBG00068
ID
JCDBG00068
Name
psbT
Type
protein_coding
Scaffold
NC_012224.1
Start
80633
End
80740
Strand
+
Link
Genbank id:7564761
Molecular function
Cellular component
GO:0016020 | membrane
GO:0009539 | photosystem II reaction center
GO:0009523 | photosystem II
Biological process
GO:0015979 | photosynthesis
KEGG
Entry: K02718
Name: psbT
Definition: photosystem II PsbT protein
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGGAAGCATTGGTTTATACATTCCTTTTAGTCTCAACTTTAGGAATCATTTTTTTCGCTATCTTTTTTCGAGAACCGCCT AAAGTTCCAACTAAAAAGGTAAAATGAT
Gene structure

JCDB Genes gff download

JCDBG00068 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00068's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00068JCDBG00028co-exp0.845636
JCDBG00068JCDBG00021co-exp0.790381
JCDBG00068JCDBG00050co-exp0.789722
JCDBG00068JCDBG00010co-exp0.778257
JCDBG00068JCDBG00040co-exp0.775985
JCDBG00068JCDBG00075co-exp0.7699
JCDBG00068JCDBG00062co-exp0.768366
JCDBG00068JCDBG00059co-exp0.763834
JCDBG00068JCDBG07881co-exp-0.757958
JCDBG00068JCDBG00065co-exp0.751155
JCDBG00028JCDBG00021co-exp0.793051
JCDBG00028JCDBG00050co-exp0.913276
JCDBG00028JCDBG00010co-exp0.771697
JCDBG00028JCDBG00040co-exp0.863392
JCDBG00028JCDBG00075co-exp0.851903
JCDBG00028JCDBG00062co-exp0.880102
JCDBG00028JCDBG00059co-exp0.859519
JCDBG00028JCDBG07881co-exp-0.803284
JCDBG00028JCDBG00065co-exp0.836263
JCDBG00021JCDBG00050co-exp0.805672
JCDBG00021JCDBG00010co-exp0.771957
JCDBG00021JCDBG00040co-exp0.761717
JCDBG00021JCDBG00075co-exp0.843724
JCDBG00021JCDBG00062co-exp0.818049
JCDBG00021JCDBG00059co-exp0.792721
JCDBG00021JCDBG07881co-exp-0.817929
JCDBG00021JCDBG00065co-exp0.836
JCDBG00050JCDBG00010co-exp0.711709
JCDBG00050JCDBG00040co-exp0.85779
JCDBG00050JCDBG00075co-exp0.919816
JCDBG00050JCDBG00062co-exp0.929095
JCDBG00050JCDBG00059co-exp0.913866
JCDBG00050JCDBG07881co-exp-0.814355
JCDBG00050JCDBG00065co-exp0.904811
JCDBG00010JCDBG00040co-exp0.755398
JCDBG00010JCDBG00075co-exp0.713186
JCDBG00010JCDBG00062co-exp0.65031
JCDBG00010JCDBG00059co-exp0.629402
JCDBG00010JCDBG07881co-exp-0.647665
JCDBG00010JCDBG00065co-exp0.624274
JCDBG00040JCDBG00075co-exp0.856433
JCDBG00040JCDBG00062co-exp0.798414
JCDBG00040JCDBG00059co-exp0.769666
JCDBG00040JCDBG07881co-exp-0.717582
JCDBG00040JCDBG00065co-exp0.757109
JCDBG00075JCDBG00062co-exp0.905767
JCDBG00075JCDBG00059co-exp0.844734
JCDBG00075JCDBG07881co-exp-0.855963
JCDBG00075JCDBG00065co-exp0.920844
JCDBG00062JCDBG00059co-exp0.900039
JCDBG00062JCDBG07881co-exp-0.856781
JCDBG00062JCDBG00065co-exp0.946062
JCDBG00059JCDBG07881co-exp-0.77181
JCDBG00059JCDBG00065co-exp0.854837
JCDBG07881JCDBG00065co-exp-0.871597
PPI network
node1node2type
JCDBR00068
ID
JCDBR00068
Name
psbT
Type
protein_coding
Scaffold
NC_012224.1
Start
80633
End
80740
Strand
+
Exon
80633-80740
Sequence
TGGAAGCATTGGTTTATACATTCCTTTTAGTCTCAACTTTAGGAATCATTTTTTTCGCTATCTTTTTTCGAGAACCGCCT AAAGTTCCAACTAAAAAGGTAAAATGAT
Product
Source
RefSeq
Link:
JCDBP00046
ID
JCDBP00046
Parent
JCDBR00068
Name
YP_002720139.1
Scaffold
NC_012224.1
CDS
80633-80740
Strand:
+
Sequence
MEALVYTFLLVSTLGIIFFAIFFREPPKVPTKKVK
Product
photosystem II protein T
Source
RefSeq
Link
YP_002720139.1
InterProScan
IPR001743 Photosystem II PsbT
Pfam
PF01405.13 PsbT Family