Detail information of JCDBG00069

JCDBG00069
ID
JCDBG00069
Name
psbN
Type
protein_coding
Scaffold
NC_012224.1
Start
80802
End
80933
Strand
-
Link
Genbank id:7564762
Molecular function
Cellular component
GO:0016020 | membrane
GO:0009539 | photosystem II reaction center
GO:0009523 | photosystem II
Biological process
GO:0015979 | photosynthesis
KEGG
Entry: K02715
Name: psbN
Definition: PsbN protein
Source
RefSeq
TF
Description
Sequence
AATGGAAACAGCAACTCTAGTCGCCATCTCTATATCTGGTTTACTTGTAAGTTTTACTGGGTATGCCTTATATACTGCTT TTGGGCAACCCTCTCAACAACTAAGAGATCCATTCGAGGAACACGGGGACTA
Gene structure

JCDB Genes gff download

JCDBG00069 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00069's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00069JCDBG00070co-exp0.930227
JCDBG00069JCDBG00037co-exp0.914379
JCDBG00069JCDBG00063co-exp0.911133
JCDBG00069JCDBG00075co-exp0.910429
JCDBG00069JCDBG00012co-exp0.905684
JCDBG00069JCDBG00062co-exp0.90278
JCDBG00069JCDBG00112co-exp0.901977
JCDBG00069JCDBG11239co-exp0.89206
JCDBG00069JCDBG00050co-exp0.883856
JCDBG00069JCDBG00065co-exp0.883197
JCDBG00070JCDBG00037co-exp0.943138
JCDBG00070JCDBG00063co-exp0.952478
JCDBG00070JCDBG00075co-exp0.901847
JCDBG00070JCDBG00012co-exp0.911621
JCDBG00070JCDBG00062co-exp0.90613
JCDBG00070JCDBG00112co-exp0.886046
JCDBG00070JCDBG11239co-exp0.898642
JCDBG00070JCDBG00050co-exp0.868485
JCDBG00070JCDBG00065co-exp0.908277
JCDBG00037JCDBG00063co-exp0.966339
JCDBG00037JCDBG00075co-exp0.939222
JCDBG00037JCDBG00012co-exp0.963833
JCDBG00037JCDBG00062co-exp0.934869
JCDBG00037JCDBG00112co-exp0.958141
JCDBG00037JCDBG11239co-exp0.943379
JCDBG00037JCDBG00050co-exp0.895607
JCDBG00037JCDBG00065co-exp0.962165
JCDBG00063JCDBG00075co-exp0.953019
JCDBG00063JCDBG00012co-exp0.938615
JCDBG00063JCDBG00062co-exp0.914786
JCDBG00063JCDBG00112co-exp0.929563
JCDBG00063JCDBG11239co-exp0.950032
JCDBG00063JCDBG00050co-exp0.890308
JCDBG00063JCDBG00065co-exp0.942622
JCDBG00075JCDBG00012co-exp0.912519
JCDBG00075JCDBG00062co-exp0.905767
JCDBG00075JCDBG00112co-exp0.92744
JCDBG00075JCDBG11239co-exp0.952265
JCDBG00075JCDBG00050co-exp0.919816
JCDBG00075JCDBG00065co-exp0.920844
JCDBG00012JCDBG00062co-exp0.910668
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG11239co-exp0.912939
JCDBG00012JCDBG00050co-exp0.866965
JCDBG00012JCDBG00065co-exp0.946607
JCDBG00062JCDBG00112co-exp0.902815
JCDBG00062JCDBG11239co-exp0.888295
JCDBG00062JCDBG00050co-exp0.929095
JCDBG00062JCDBG00065co-exp0.946062
JCDBG00112JCDBG11239co-exp0.919971
JCDBG00112JCDBG00050co-exp0.875256
JCDBG00112JCDBG00065co-exp0.944148
JCDBG11239JCDBG00050co-exp0.877795
JCDBG11239JCDBG00065co-exp0.91345
JCDBG00050JCDBG00065co-exp0.904811
PPI network
node1node2type
JCDBR00069
ID
JCDBR00069
Name
psbN
Type
protein_coding
Scaffold
NC_012224.1
Start
80802
End
80933
Strand
-
Exon
80802-80933
Sequence
AATGGAAACAGCAACTCTAGTCGCCATCTCTATATCTGGTTTACTTGTAAGTTTTACTGGGTATGCCTTATATACTGCTT TTGGGCAACCCTCTCAACAACTAAGAGATCCATTCGAGGAACACGGGGACTA
Product
Source
RefSeq
Link:
JCDBP00047
ID
JCDBP00047
Parent
JCDBR00069
Name
YP_002720140.1
Scaffold
NC_012224.1
CDS
80802-80933
Strand:
-
Sequence
METATLVAISISGLLVSFTGYALYTAFGQPSQQLRDPFEEHGD
Product
photosystem II protein N
Source
RefSeq
Link
YP_002720140.1
InterProScan
IPR003398 Photosystem II PsbN
Pfam
PF02468.11 PsbN Family