Detail information of JCDBG00070

JCDBG00070
ID
JCDBG00070
Name
psbH
Type
protein_coding
Scaffold
NC_012224.1
Start
81037
End
81258
Strand
+
Link
Genbank id:7564763 | Jatropha Genome Database ID:Jcr4S14121.10
Molecular function
GO:0042301 | phosphate ion binding
Cellular component
GO:0016020 | membrane
GO:0009523 | photosystem II
Biological process
GO:0050821 | protein stabilization
GO:0015979 | photosynthesis
KEGG
Entry: K02709
Name: psbH
Definition: photosystem II PsbH protein
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGGCTACACAAAGTGTGGAGGGTAGTTCTAGATCTGGTCCAAGACGAACTGTTGTAGGGGATTTATTGAAACCATTGAAT TCGGAATATGGTAAAGTAGCTCCTGGATGGGGAACCACTCCCTTGATGGGTGTTGCAATGGCTCTATTTGCGATATTCCT ATCTATTATTTTAGAAATTTATAATTCTTCCGTTTTACTAGATGGAATTTCAATGAATTAGA
Gene structure

JCDB Genes gff download

JCDBG00070 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00070's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00070JCDBG00063co-exp0.952478
JCDBG00070JCDBG00037co-exp0.943138
JCDBG00070JCDBG00069co-exp0.930227
JCDBG00070JCDBG00046co-exp0.918786
JCDBG00070JCDBG00032co-exp0.913395
JCDBG00070JCDBG00012co-exp0.911621
JCDBG00070JCDBG21199co-exp0.910026
JCDBG00070JCDBG07355co-exp0.909479
JCDBG00070JCDBG00065co-exp0.908277
JCDBG00070JCDBG00062co-exp0.90613
JCDBG00063JCDBG00037co-exp0.966339
JCDBG00063JCDBG00069co-exp0.911133
JCDBG00063JCDBG00046co-exp0.932346
JCDBG00063JCDBG00032co-exp0.894993
JCDBG00063JCDBG00012co-exp0.938615
JCDBG00063JCDBG21199co-exp0.914276
JCDBG00063JCDBG07355co-exp0.927425
JCDBG00063JCDBG00065co-exp0.942622
JCDBG00063JCDBG00062co-exp0.914786
JCDBG00037JCDBG00069co-exp0.914379
JCDBG00037JCDBG00046co-exp0.956923
JCDBG00037JCDBG00032co-exp0.917854
JCDBG00037JCDBG00012co-exp0.963833
JCDBG00037JCDBG21199co-exp0.918742
JCDBG00037JCDBG07355co-exp0.930475
JCDBG00037JCDBG00065co-exp0.962165
JCDBG00037JCDBG00062co-exp0.934869
JCDBG00069JCDBG00046co-exp0.864569
JCDBG00069JCDBG00032co-exp0.858205
JCDBG00069JCDBG00012co-exp0.905684
JCDBG00069JCDBG21199co-exp0.851022
JCDBG00069JCDBG07355co-exp0.851028
JCDBG00069JCDBG00065co-exp0.883197
JCDBG00069JCDBG00062co-exp0.90278
JCDBG00046JCDBG00032co-exp0.945749
JCDBG00046JCDBG00012co-exp0.949104
JCDBG00046JCDBG21199co-exp0.870369
JCDBG00046JCDBG07355co-exp0.936736
JCDBG00046JCDBG00065co-exp0.954196
JCDBG00046JCDBG00062co-exp0.908979
JCDBG00032JCDBG00012co-exp0.935341
JCDBG00032JCDBG21199co-exp0.874227
JCDBG00032JCDBG07355co-exp0.933694
JCDBG00032JCDBG00065co-exp0.899738
JCDBG00032JCDBG00062co-exp0.87634
JCDBG00012JCDBG21199co-exp0.895677
JCDBG00012JCDBG07355co-exp0.91033
JCDBG00012JCDBG00065co-exp0.946607
JCDBG00012JCDBG00062co-exp0.910668
JCDBG21199JCDBG07355co-exp0.884359
JCDBG21199JCDBG00065co-exp0.849029
JCDBG21199JCDBG00062co-exp0.849479
JCDBG07355JCDBG00065co-exp0.934898
JCDBG07355JCDBG00062co-exp0.891163
JCDBG00065JCDBG00062co-exp0.946062
PPI network
node1node2type
JCDBR00070
ID
JCDBR00070
Name
psbH
Type
protein_coding
Scaffold
NC_012224.1
Start
81037
End
81258
Strand
+
Exon
81037-81258
Sequence
TGGCTACACAAAGTGTGGAGGGTAGTTCTAGATCTGGTCCAAGACGAACTGTTGTAGGGGATTTATTGAAACCATTGAAT TCGGAATATGGTAAAGTAGCTCCTGGATGGGGAACCACTCCCTTGATGGGTGTTGCAATGGCTCTATTTGCGATATTCCT ATCTATTATTTTAGAAATTTATAATTCTTCCGTTTTACTAGATGGAATTTCAATGAATTAGA
Product
Source
RefSeq
Link:
JCDBP00048
ID
JCDBP00048
Parent
JCDBR00070
Name
YP_002720141.1
Scaffold
NC_012224.1
CDS
81037-81258
Strand:
+
Sequence
MATQSVEGSSRSGPRRTVVGDLLKPLNSEYGKVAPGWGTTPLMGVAMALFAIFLSIILEIYNSSVLLDGISMN
Product
photosystem II protein H
Source
RefSeq
Link
YP_002720141.1
InterProScan
IPR001056 Photosystem II PsbH, phosphoprotein
Pfam
PF00737.16 PsbH Family