Detail information of JCDBG00071

JCDBG00071
ID
JCDBG00071
Name
petB
Type
protein_coding
Scaffold
NC_012224.1
Start
81321
End
82746
Strand
+
Link
Genbank id:7564764
Molecular function
GO:0009055 | electron carrier activity
GO:0020037 | heme binding
GO:0005506 | iron ion binding
GO:0045158 | electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
GO:0016491 | oxidoreductase activity
Cellular component
GO:0016020 | membrane
GO:0016021 | integral component of membrane
Biological process
GO:0022900 | electron transport chain
GO:0022904 | respiratory electron transport chain
KEGG
Entry: K02635
Name: petB
Definition: cytochrome b6
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGAGTGTGCGACTTGTTATAATTGATCCTATTGATAGTACAGAGAGTGGGTCTGTCATCTTGATAGAGATGATTTTTTAT CTCGTCAGGTATTTATTCTAGTATCTGGAGCACGGAATATATGAAAAAGATTACGAAGTATTAGAACTATGATTCATACT TAATATTCAGATCTCGTGGCCGGACTCCAAAAAATTTCAGAGGGTATAAATTGAAAGATTTTTCTTCTTTCAAACTCTTT ATCTTTGTTTGATCAAAGGACAAACCTTTCTTTGGATTTTTACTCATTATATTTATTCATTGAATAAGTGATGATACAAC GGTTCTTACTCAAGGAATCTTTGGACTTAGTTTGAAGGTTTTATTAAATCATCGTGGTTCTAGTATGAATCTGAGGTTTC AATCGATTTATAGGATCTTAACAAGAAAATTCCTATTAACAATTAATAATAAAGAAAACAATAACAAGCCTGCATTACAT ACAAATAAAAATACTAAATCAAGGAAAAAAAAAATGGGTAAATAAAATAGAAGATTCAAGAGGCCTATAATAATCAACAT CAAGAGATGAATGAGCCGACTTGATATTTTGGCATTATAACCACAAAGAAGAGTTTTCGGGTTTTTCGTATCGTCATCTT CAGAGAAAACTGTTGAATTATAGGATTAAGAAGTTTCTATTACACATCAACTAGTATTTGGGTGGTTCTGTTTGAGCCGT ACGAGATGAAATTCTCATATACGGTTCTCGGAGGGGGAGTCCTTCTGGTTTACCTATCTCAATAAAGTTTATGATTGGTT CGAAGAACGTCTCGAGATTCAGGCGATTGCAGATGATATAACTAGTAAATATGTTCCTCCCCATGTCAACATATTTTATT GTTTAGGAGGAATTACGCTTACTTGTTTTTTAGTACAAGTAGCTACGGGATTTGCTATGACTTTTTACTACCGTCCGACC GTTACTGAGGCTTTTGCTTCTGTTCAATACATAATGACTGAAGCTAACTTTGGTTGGTTAATCCGATCAGTTCATCGATG GTCGGCAAGTATGATGGTTTTAATGATGATCCTGCACGTATTTCGTGTGTATCTCACTGGTGGCTTTAAAAAACCTCGTG AATTGACTTGGGTTACGGGCGTGGTTCTTGCTGTATTGACCGCATCTTTTGGTGTAACCGGTTATTCCTTACCTTGGGAC CAAATTGGTTATTGGGCAGTCAAAATTGTAACAGGCGTGCCGGAAGCTATTCCTGTAATAGGATCGCCTTTGGTAGAGTT ATTACGTGGAAGCGCTAGTGTAGGACAATCCACTTTGACTCGTTTTTATAGTTTACACACTTTTGTATTACCCCTCCTTA CTGCCGTATTTATGTTAATGCACTTTTCAATGATACGTAAGCAAGGTATTTCAGGCCCTTTATAGA
Gene structure

JCDB Genes gff download

JCDBG00071 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00071's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00071JCDBG00047co-exp0.937953
JCDBG00071JCDBG00026co-exp0.934561
JCDBG00071JCDBG00027co-exp0.925427
JCDBG00071JCDBG00067co-exp0.921919
JCDBG00071JCDBG00033co-exp0.899852
JCDBG00071JCDBG00002co-exp0.893332
JCDBG00071JCDBG00042co-exp0.860909
JCDBG00071JCDBG00072co-exp0.850068
JCDBG00071JCDBG00034co-exp0.815403
JCDBG00071JCDBG00048co-exp0.8096
JCDBG00047JCDBG00026co-exp0.916383
JCDBG00047JCDBG00027co-exp0.913089
JCDBG00047JCDBG00067co-exp0.923353
JCDBG00047JCDBG00033co-exp0.885043
JCDBG00047JCDBG00002co-exp0.867959
JCDBG00047JCDBG00042co-exp0.899261
JCDBG00047JCDBG00072co-exp0.861011
JCDBG00047JCDBG00034co-exp0.836956
JCDBG00047JCDBG00048co-exp0.772043
JCDBG00026JCDBG00027co-exp0.967986
JCDBG00026JCDBG00067co-exp0.902249
JCDBG00026JCDBG00033co-exp0.950075
JCDBG00026JCDBG00002co-exp0.926188
JCDBG00026JCDBG00042co-exp0.811813
JCDBG00026JCDBG00072co-exp0.818663
JCDBG00026JCDBG00034co-exp0.863772
JCDBG00026JCDBG00048co-exp0.835686
JCDBG00027JCDBG00067co-exp0.928913
JCDBG00027JCDBG00033co-exp0.935167
JCDBG00027JCDBG00002co-exp0.921385
JCDBG00027JCDBG00042co-exp0.810646
JCDBG00027JCDBG00072co-exp0.834429
JCDBG00027JCDBG00034co-exp0.884364
JCDBG00027JCDBG00048co-exp0.818448
JCDBG00067JCDBG00033co-exp0.87946
JCDBG00067JCDBG00002co-exp0.859833
JCDBG00067JCDBG00042co-exp0.900122
JCDBG00067JCDBG00072co-exp0.876583
JCDBG00067JCDBG00034co-exp0.84116
JCDBG00067JCDBG00048co-exp0.722515
JCDBG00033JCDBG00002co-exp0.899406
JCDBG00033JCDBG00042co-exp0.779329
JCDBG00033JCDBG00072co-exp0.825452
JCDBG00033JCDBG00034co-exp0.902027
JCDBG00033JCDBG00048co-exp0.814849
JCDBG00002JCDBG00042co-exp0.746694
JCDBG00002JCDBG00072co-exp0.717616
JCDBG00002JCDBG00034co-exp0.816051
JCDBG00002JCDBG00048co-exp0.845832
JCDBG00042JCDBG00072co-exp0.888954
JCDBG00042JCDBG00034co-exp0.778555
JCDBG00072JCDBG00034co-exp0.849769
JCDBG00072JCDBG00048co-exp0.601336
JCDBG00034JCDBG00048co-exp0.674514
PPI network
node1node2type
JCDBR00071
ID
JCDBR00071
Name
petB
Type
protein_coding
Scaffold
NC_012224.1
Start
81321
End
82746
Strand
+
Exon
81321-81326,82105-82746
Sequence
TGAGTGTGCGACTTGTTATAATTGATCCTATTGATAGTACAGAGAGTGGGTCTGTCATCTTGATAGAGATGATTTTTTAT CTCGTCAGGTATTTATTCTAGTATCTGGAGCACGGAATATATGAAAAAGATTACGAAGTATTAGAACTATGATTCATACT TAATATTCAGATCTCGTGGCCGGACTCCAAAAAATTTCAGAGGGTATAAATTGAAAGATTTTTCTTCTTTCAAACTCTTT ATCTTTGTTTGATCAAAGGACAAACCTTTCTTTGGATTTTTACTCATTATATTTATTCATTGAATAAGTGATGATACAAC GGTTCTTACTCAAGGAATCTTTGGACTTAGTTTGAAGGTTTTATTAAATCATCGTGGTTCTAGTATGAATCTGAGGTTTC AATCGATTTATAGGATCTTAACAAGAAAATTCCTATTAACAATTAATAATAAAGAAAACAATAACAAGCCTGCATTACAT ACAAATAAAAATACTAAATCAAGGAAAAAAAAAATGGGTAAATAAAATAGAAGATTCAAGAGGCCTATAATAATCAACAT CAAGAGATGAATGAGCCGACTTGATATTTTGGCATTATAACCACAAAGAAGAGTTTTCGGGTTTTTCGTATCGTCATCTT CAGAGAAAACTGTTGAATTATAGGATTAAGAAGTTTCTATTACACATCAACTAGTATTTGGGTGGTTCTGTTTGAGCCGT ACGAGATGAAATTCTCATATACGGTTCTCGGAGGGGGAGTCCTTCTGGTTTACCTATCTCAATAAAGTTTATGATTGGTT CGAAGAACGTCTCGAGATTCAGGCGATTGCAGATGATATAACTAGTAAATATGTTCCTCCCCATGTCAACATATTTTATT GTTTAGGAGGAATTACGCTTACTTGTTTTTTAGTACAAGTAGCTACGGGATTTGCTATGACTTTTTACTACCGTCCGACC GTTACTGAGGCTTTTGCTTCTGTTCAATACATAATGACTGAAGCTAACTTTGGTTGGTTAATCCGATCAGTTCATCGATG GTCGGCAAGTATGATGGTTTTAATGATGATCCTGCACGTATTTCGTGTGTATCTCACTGGTGGCTTTAAAAAACCTCGTG AATTGACTTGGGTTACGGGCGTGGTTCTTGCTGTATTGACCGCATCTTTTGGTGTAACCGGTTATTCCTTACCTTGGGAC CAAATTGGTTATTGGGCAGTCAAAATTGTAACAGGCGTGCCGGAAGCTATTCCTGTAATAGGATCGCCTTTGGTAGAGTT ATTACGTGGAAGCGCTAGTGTAGGACAATCCACTTTGACTCGTTTTTATAGTTTACACACTTTTGTATTACCCCTCCTTA CTGCCGTATTTATGTTAATGCACTTTTCAATGATACGTAAGCAAGGTATTTCAGGCCCTTTATAGA
Product
Source
RefSeq
Link:
JCDBP00049
ID
JCDBP00049
Parent
JCDBR00071
Name
YP_002720142.1
Scaffold
NC_012224.1
CDS
81321-81326,82105-82746
Strand:
+
Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFASVQYIMTEANFGW LIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPV IGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL
Product
cytochrome b6
Source
RefSeq
Link
YP_002720142.1
InterProScan
IPR005797 Cytochrome b/b6, N-terminal
IPR016174 Di-haem cytochrome, transmembrane
IPR023530 Cytochrome b6, PetB
IPR027387 Cytochrome b/b6-like domain
Pfam
PF13631.2 Cytochrom_B_N_2 Domain