Detail information of JCDBG00072

JCDBG00072
ID
JCDBG00072
Name
petD
Type
protein_coding
Scaffold
NC_012224.1
Start
82940
End
84304
Strand
+
Link
Genbank id:7564765
Molecular function
GO:0009055 | electron carrier activity
GO:0045156 | electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0016491 | oxidoreductase activity
Cellular component
GO:0016020 | membrane
GO:0042651 | thylakoid membrane
Biological process
GO:0009767 | photosynthetic electron transport chain
KEGG
Entry: K02637
Name: petD
Definition: cytochrome b6-f complex subunit 4
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
TGGGAGTGTGTGACTTGGACTATTGATTTGGCCGTGCAGATATATGCCTTTATCCGCCACATTGGAATTAATAACCAAAT GTGTCTTTGTTCCAACCACTGCGAAAGCCCCATACAGAGGATAGGCTGGTTCGCTTGAAGAGAATCTTTTCTATGATCAG TCTAACATGTTGTGCATGAACAGGCTCCGTAAAACCCAGTAGAATAAGTGATGTGGTAAAATCTATATTCTATTTTAGCT ATTTTACTTATTTATACTTAGTTTTATTTTATTTATTTCATTTACTTAACATTTACTTAATTACTTAATACTATTACTTA ATACTTTATTACTTATTTATTACTTAATATACTTAATACTTTATAGTATGGAAATGCAGTCATTTCCTCTGCATTGACCC GATTTAGGATACTATCGGAGTGAAGTGAAATAAGGGATCTAAAGAATGACAGAGGCTAAACTCTATTAGTAACAAGTAAA TCCTTTGTATGTAAAAAGTATCGATATTTTTTGGAGATAAAAGCCAATCGAAAGGTCTGAGACGACCCAAAAAGCATTTG ATCATGATCACCTTTTAGGCCTACTTGGGTATTGAGCATTTACCTGTAAAAATGAATTCTTTGCAATGGATAATTGCAAC TCTGGAAAAAGGAATCCAATTATTATTACAAAAAAATCATTCATACATATATGTGTAGACATGGCTAACATATAGATATA GATTTTATAACGTCTAGACATACAAGATTTTTTTATTTTTTATATGGATCCGTTTGATTCATTTAATTCTTGCTCGAGCC GGATGATGAAAAATTGTCATGTCCGGTTCTTTCGGAGGATGGATCTATAAGAATTCACCTATCCCAATAACAAAAAAACC TGACTTGAATGATCCTGTATTAAGAGCTAAATTGGCTAAGGGAATGGGTCATAATTATTACGGAGAACCTGCATGGCCCA ATGATCTTTTATATATTTTTCCAGTAGTAATTCTAGGTACTATTGCGTGTAATGTAGGATTAGCGGTTCTAGAGCCGTCA ATGATTGGTGAACCTGCGGATCCATTTGCAACTCCTTTAGAGATATTGCCTGAATGGTATTTTTTTCCTGTATTTCAAAT ACTTCGTACAGTACCCAATAAGTTATTGGGTGTTCTTTTAATGGTTTCAGTACCTGCAGGATTATTAACAGTACCCTTTT TGGAGAATGTTAATAAATTCCAAAATCCATTTCGTCGCCCAGTTGCGACAACCGTCTTTTTGATTGGTACTGCAGTAGCC CTTTGGTTAGGTATTGGAGCAACATTACCTATTGATAAATCCCTAACTTTAGGTCTTTTTCAAATTGATTCAATTGTAAA ATAAA
Gene structure

JCDB Genes gff download

JCDBG00072 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00072's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00072JCDBG00042co-exp0.888954
JCDBG00072JCDBG00100co-exp0.887318
JCDBG00072JCDBG00067co-exp0.876583
JCDBG00072JCDBG00047co-exp0.861011
JCDBG00072JCDBG08646co-exp-0.856691
JCDBG00072JCDBG00071co-exp0.850068
JCDBG00072JCDBG00034co-exp0.849769
JCDBG00072JCDBG00011co-exp0.837624
JCDBG00072JCDBG00027co-exp0.834429
JCDBG00072JCDBG00041co-exp0.831358
JCDBG00042JCDBG00100co-exp0.91609
JCDBG00042JCDBG00067co-exp0.900122
JCDBG00042JCDBG00047co-exp0.899261
JCDBG00042JCDBG08646co-exp-0.744977
JCDBG00042JCDBG00071co-exp0.860909
JCDBG00042JCDBG00034co-exp0.778555
JCDBG00042JCDBG00011co-exp0.778524
JCDBG00042JCDBG00027co-exp0.810646
JCDBG00042JCDBG00041co-exp0.747617
JCDBG00100JCDBG00067co-exp0.81633
JCDBG00100JCDBG00047co-exp0.821621
JCDBG00100JCDBG08646co-exp-0.766268
JCDBG00100JCDBG00071co-exp0.775348
JCDBG00100JCDBG00034co-exp0.739465
JCDBG00100JCDBG00011co-exp0.815082
JCDBG00100JCDBG00027co-exp0.720751
JCDBG00100JCDBG00041co-exp0.801022
JCDBG00067JCDBG00047co-exp0.923353
JCDBG00067JCDBG08646co-exp-0.807184
JCDBG00067JCDBG00071co-exp0.921919
JCDBG00067JCDBG00034co-exp0.84116
JCDBG00067JCDBG00011co-exp0.698951
JCDBG00067JCDBG00027co-exp0.928913
JCDBG00067JCDBG00041co-exp0.662484
JCDBG00047JCDBG08646co-exp-0.731547
JCDBG00047JCDBG00071co-exp0.937953
JCDBG00047JCDBG00034co-exp0.836956
JCDBG00047JCDBG00011co-exp0.692492
JCDBG00047JCDBG00027co-exp0.913089
JCDBG00047JCDBG00041co-exp0.681668
JCDBG08646JCDBG00071co-exp-0.729506
JCDBG08646JCDBG00034co-exp-0.732295
JCDBG08646JCDBG00011co-exp-0.739491
JCDBG08646JCDBG00027co-exp-0.757426
JCDBG08646JCDBG00041co-exp-0.733082
JCDBG00071JCDBG00034co-exp0.815403
JCDBG00071JCDBG00011co-exp0.629326
JCDBG00071JCDBG00027co-exp0.925427
JCDBG00071JCDBG00041co-exp0.62637
JCDBG00034JCDBG00011co-exp0.723432
JCDBG00034JCDBG00027co-exp0.884364
JCDBG00034JCDBG00041co-exp0.766005
JCDBG00011JCDBG00041co-exp0.909905
JCDBG00027JCDBG00041co-exp0.613501
PPI network
node1node2type
JCDBR00072
ID
JCDBR00072
Name
petD
Type
protein_coding
Scaffold
NC_012224.1
Start
82940
End
84304
Strand
+
Exon
82940-82947,83809-84304
Sequence
TGGGAGTGTGTGACTTGGACTATTGATTTGGCCGTGCAGATATATGCCTTTATCCGCCACATTGGAATTAATAACCAAAT GTGTCTTTGTTCCAACCACTGCGAAAGCCCCATACAGAGGATAGGCTGGTTCGCTTGAAGAGAATCTTTTCTATGATCAG TCTAACATGTTGTGCATGAACAGGCTCCGTAAAACCCAGTAGAATAAGTGATGTGGTAAAATCTATATTCTATTTTAGCT ATTTTACTTATTTATACTTAGTTTTATTTTATTTATTTCATTTACTTAACATTTACTTAATTACTTAATACTATTACTTA ATACTTTATTACTTATTTATTACTTAATATACTTAATACTTTATAGTATGGAAATGCAGTCATTTCCTCTGCATTGACCC GATTTAGGATACTATCGGAGTGAAGTGAAATAAGGGATCTAAAGAATGACAGAGGCTAAACTCTATTAGTAACAAGTAAA TCCTTTGTATGTAAAAAGTATCGATATTTTTTGGAGATAAAAGCCAATCGAAAGGTCTGAGACGACCCAAAAAGCATTTG ATCATGATCACCTTTTAGGCCTACTTGGGTATTGAGCATTTACCTGTAAAAATGAATTCTTTGCAATGGATAATTGCAAC TCTGGAAAAAGGAATCCAATTATTATTACAAAAAAATCATTCATACATATATGTGTAGACATGGCTAACATATAGATATA GATTTTATAACGTCTAGACATACAAGATTTTTTTATTTTTTATATGGATCCGTTTGATTCATTTAATTCTTGCTCGAGCC GGATGATGAAAAATTGTCATGTCCGGTTCTTTCGGAGGATGGATCTATAAGAATTCACCTATCCCAATAACAAAAAAACC TGACTTGAATGATCCTGTATTAAGAGCTAAATTGGCTAAGGGAATGGGTCATAATTATTACGGAGAACCTGCATGGCCCA ATGATCTTTTATATATTTTTCCAGTAGTAATTCTAGGTACTATTGCGTGTAATGTAGGATTAGCGGTTCTAGAGCCGTCA ATGATTGGTGAACCTGCGGATCCATTTGCAACTCCTTTAGAGATATTGCCTGAATGGTATTTTTTTCCTGTATTTCAAAT ACTTCGTACAGTACCCAATAAGTTATTGGGTGTTCTTTTAATGGTTTCAGTACCTGCAGGATTATTAACAGTACCCTTTT TGGAGAATGTTAATAAATTCCAAAATCCATTTCGTCGCCCAGTTGCGACAACCGTCTTTTTGATTGGTACTGCAGTAGCC CTTTGGTTAGGTATTGGAGCAACATTACCTATTGATAAATCCCTAACTTTAGGTCTTTTTCAAATTGATTCAATTGTAAA ATAAA
Product
Source
RefSeq
Link:
JCDBP00050
ID
JCDBP00050
Parent
JCDBR00072
Name
YP_002720143.1
Scaffold
NC_012224.1
CDS
82940-82947,83809-84304
Strand:
+
Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWY FFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF QIDSIVK
Product
cytochrome b6/f complex subunit IV
Source
RefSeq
Link
YP_002720143.1
InterProScan
IPR005798 Cytochrome b/b6, C-terminal
IPR005870 Cytochrome b6/f complex, subunit IV
Pfam
PF00032.13 Cytochrom_B_C Domain