Detail information of JCDBG00073

JCDBG00073
ID
JCDBG00073
Name
rpoA
Type
protein_coding
Scaffold
NC_012224.1
Start
84516
End
85535
Strand
-
Link
Genbank id:7564766 | Jatropha Genome Database ID:Jcr4S26587.10
Molecular function
GO:0003899 | DNA-directed RNA polymerase activity
GO:0003677 | DNA binding
GO:0046983 | protein dimerization activity
Cellular component
Biological process
GO:0006351 | transcription, DNA-templated
KEGG
Entry: K03040
Name: rpoA
Definition: DNA-directed RNA polymerase subunit alpha [EC:2.7.7.6]
ko00230:   Purine metabolism
ko00240:   Pyrimidine metabolism
ko03020:   RNA polymerase
Source
RefSeq
TF
Description
Sequence
TATGGTTCGAGAGAAAGTAACAATATCTACTCGGACACTGCAGTGGAAATGTGTTGAATCAAGAACGGACAATAAACGTC TTTATTATGGACGCTTTATTCTATCTCCACTTATGAAAGGCCAAGCTGACACAATAGGCATTGCGATGCGAAGAGCTTTG CTTGGAGAAATAGAAGGAACATGTATCACACGTGCAAAATCTGAGAAAATACCACACGAATTTTCTACTATAGCAGGTAT TCAAGAATCAATACATGAAATTTTAATGAATTTGAAAAATGTTGTATTGAAAAGCAATTTGTATGGAACTTGTGACGCGT CTATTTATGTCAAAGGTCCTGGATATGTAACTGCCCAAGACATCATCTTACCGCCTTTTGTGGAAATTATTGATAATACA CAGCATATCGCTAGCCTAACGGAATCAATTGATTTGTGTATTGGATTACAAATCGAGAGGAATCGCGGCTATCGTATAAA ACCGACAAATAACTTTCAGGACGGAAGTTATCCTATAGATGCTGTATTCATGCCTGTTCGAAATGCGAATCATAGTGTTC ATTCTTATGGAAATGGAAATGAAAAGCAAGAGATACTTTTTCTCGAAATATGGACAAACGGAAGTTTAACTCCTAAAGAA GCACTTCATGAAGCCTCCCGAAATTTGATTGATTTATTTATTCCTTTTCTACATGCAGAAGAAGAAAACTTACATTTAGA AATAAATCAACACAAGGTTACTTTACCCCTTTTTACTTTTCATGGTAGATTGACTAAATTAAGAAAAAATCAAAAAGAAA TAGCATTGAAATACATTTTTATTGACCAATCAGAATTGACCCCTAAGACCTATAATTGCCTCAAAAGGTCCAATATACAT ACATTATCGGACCTTTTAAATAAGAGTCAAGAAGATCTTATGAAAATTGAAAATTTTCGCATAGACGATGTAAAACATAT ATTGGGTATTCTAGAAATAGAAAAACATTTCGCAATTGATTTACCAAAGAATAAAATATA
Gene structure

JCDB Genes gff download

JCDBG00073 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00073's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00073JCDBG00074co-exp0.919097
JCDBG00073JCDBG00076co-exp0.907254
JCDBG00073JCDBG00042co-exp0.877775
JCDBG00073JCDBG00100co-exp0.863882
JCDBG00073JCDBG00014co-exp0.847308
JCDBG00073JCDBG00017co-exp0.843437
JCDBG00073JCDBG00016co-exp0.842042
JCDBG00073JCDBG00015co-exp0.832888
JCDBG00073JCDBG00011co-exp0.809354
JCDBG00073JCDBG00072co-exp0.777219
JCDBG00074JCDBG00076co-exp0.954077
JCDBG00074JCDBG00042co-exp0.855675
JCDBG00074JCDBG00100co-exp0.80827
JCDBG00074JCDBG00014co-exp0.908064
JCDBG00074JCDBG00017co-exp0.864342
JCDBG00074JCDBG00016co-exp0.898756
JCDBG00074JCDBG00015co-exp0.915663
JCDBG00074JCDBG00011co-exp0.705311
JCDBG00074JCDBG00072co-exp0.702242
JCDBG00076JCDBG00042co-exp0.878569
JCDBG00076JCDBG00100co-exp0.852873
JCDBG00076JCDBG00014co-exp0.927644
JCDBG00076JCDBG00017co-exp0.827276
JCDBG00076JCDBG00016co-exp0.885852
JCDBG00076JCDBG00015co-exp0.930852
JCDBG00076JCDBG00011co-exp0.697809
JCDBG00076JCDBG00072co-exp0.727517
JCDBG00042JCDBG00100co-exp0.91609
JCDBG00042JCDBG00014co-exp0.895739
JCDBG00042JCDBG00017co-exp0.821724
JCDBG00042JCDBG00016co-exp0.87673
JCDBG00042JCDBG00015co-exp0.895991
JCDBG00042JCDBG00011co-exp0.778524
JCDBG00042JCDBG00072co-exp0.888954
JCDBG00100JCDBG00014co-exp0.790546
JCDBG00100JCDBG00017co-exp0.742444
JCDBG00100JCDBG00016co-exp0.848717
JCDBG00100JCDBG00015co-exp0.823086
JCDBG00100JCDBG00011co-exp0.815082
JCDBG00100JCDBG00072co-exp0.887318
JCDBG00014JCDBG00017co-exp0.844381
JCDBG00014JCDBG00016co-exp0.880861
JCDBG00014JCDBG00015co-exp0.962428
JCDBG00014JCDBG00011co-exp0.602126
JCDBG00014JCDBG00072co-exp0.717311
JCDBG00017JCDBG00016co-exp0.87755
JCDBG00017JCDBG00015co-exp0.837062
JCDBG00017JCDBG00011co-exp0.6179
JCDBG00017JCDBG00072co-exp0.653705
JCDBG00016JCDBG00015co-exp0.940419
JCDBG00016JCDBG00011co-exp0.724041
JCDBG00016JCDBG00072co-exp0.783128
JCDBG00015JCDBG00011co-exp0.630853
JCDBG00015JCDBG00072co-exp0.750358
JCDBG00011JCDBG00072co-exp0.837624
PPI network
node1node2type
JCDBG00073JCDBG24182PPI
JCDBG00073JCDBG18579PPI
JCDBG00073JCDBG16654PPI
JCDBG00073JCDBG07926PPI
JCDBG00073JCDBG24664PPI
JCDBG00073JCDBG21369PPI
JCDBG00073JCDBG08740PPI
JCDBG00073JCDBG23880PPI
JCDBG00073JCDBG13802PPI
JCDBG00073JCDBG24169PPI
JCDBG00073JCDBG03794PPI
JCDBG00073JCDBG18405PPI
JCDBG00073JCDBG03611PPI
JCDBG00073JCDBG21164PPI
JCDBG00073JCDBG17129PPI
JCDBG00073JCDBG09164PPI
JCDBG00073JCDBG06148PPI
JCDBG00073JCDBG18679PPI
JCDBG00073JCDBG00558PPI
JCDBG00073JCDBG07506PPI
JCDBG00073JCDBG04400PPI
JCDBG00073JCDBG15223PPI
JCDBG00073JCDBG03609PPI
JCDBG00073JCDBG17821PPI
JCDBG00073JCDBG09074PPI
JCDBG00073JCDBG07173PPI
JCDBG00073JCDBG09453PPI
JCDBG00073JCDBG12398PPI
JCDBG00073JCDBG08109PPI
JCDBG00073JCDBG09698PPI
JCDBG00073JCDBG06075PPI
JCDBG00073JCDBG18419PPI
JCDBG00073JCDBG20116PPI
JCDBG00073JCDBG08310PPI
JCDBG00073JCDBG22117PPI
JCDBG00073JCDBG20886PPI
JCDBG24182JCDBG16654PPI
JCDBG24182JCDBG21369PPI
JCDBG24182JCDBG23880PPI
JCDBG24182JCDBG13802PPI
JCDBG24182JCDBG24169PPI
JCDBG24182JCDBG03794PPI
JCDBG24182JCDBG18405PPI
JCDBG24182JCDBG17129PPI
JCDBG24182JCDBG09164PPI
JCDBG24182JCDBG06148PPI
JCDBG24182JCDBG00558PPI
JCDBG24182JCDBG07506PPI
JCDBG24182JCDBG12398PPI
JCDBG24182JCDBG08109PPI
JCDBG24182JCDBG18419PPI
JCDBG24182JCDBG22117PPI
JCDBG18579JCDBG07173PPI
JCDBG16654JCDBG24664PPI
JCDBG16654JCDBG23880PPI
JCDBG16654JCDBG13802PPI
JCDBG16654JCDBG24169PPI
JCDBG16654JCDBG03794PPI
JCDBG16654JCDBG18405PPI
JCDBG16654JCDBG06148PPI
JCDBG16654JCDBG07506PPI
JCDBG16654JCDBG15223PPI
JCDBG16654JCDBG17821PPI
JCDBG16654JCDBG12398PPI
JCDBG16654JCDBG08109PPI
JCDBG16654JCDBG18419PPI
JCDBG07926JCDBG23880PPI
JCDBG07926JCDBG06148PPI
JCDBG07926JCDBG04400PPI
JCDBG07926JCDBG07173PPI
JCDBG07926JCDBG22117PPI
JCDBG24664JCDBG23880PPI
JCDBG24664JCDBG08310PPI
JCDBG21369JCDBG23880PPI
JCDBG21369JCDBG18405PPI
JCDBG21369JCDBG04400PPI
JCDBG21369JCDBG17821PPI
JCDBG21369JCDBG09074PPI
JCDBG21369JCDBG07173PPI
JCDBG21369JCDBG08109PPI
JCDBG08740JCDBG17821PPI
JCDBG08740JCDBG06075PPI
JCDBG08740JCDBG20116PPI
JCDBG23880JCDBG13802PPI
JCDBG23880JCDBG03794PPI
JCDBG23880JCDBG17129PPI
JCDBG23880JCDBG09164PPI
JCDBG23880JCDBG06148PPI
JCDBG23880JCDBG00558PPI
JCDBG23880JCDBG07506PPI
JCDBG23880JCDBG17821PPI
JCDBG23880JCDBG08109PPI
JCDBG23880JCDBG20116PPI
JCDBG23880JCDBG08310PPI
JCDBG13802JCDBG09164PPI
JCDBG13802JCDBG06148PPI
JCDBG13802JCDBG12398PPI
JCDBG24169JCDBG17129PPI
JCDBG03794JCDBG17129PPI
JCDBG03794JCDBG06148PPI
JCDBG03794JCDBG00558PPI
JCDBG03794JCDBG17821PPI
JCDBG03794JCDBG09698PPI
JCDBG03794JCDBG06075PPI
JCDBG03794JCDBG18419PPI
JCDBG03794JCDBG20116PPI
JCDBG18405JCDBG17129PPI
JCDBG18405JCDBG09164PPI
JCDBG18405JCDBG17821PPI
JCDBG03611JCDBG21164PPI
JCDBG03611JCDBG18679PPI
JCDBG03611JCDBG03609PPI
JCDBG21164JCDBG18679PPI
JCDBG21164JCDBG03609PPI
JCDBG17129JCDBG04400PPI
JCDBG17129JCDBG15223PPI
JCDBG17129JCDBG17821PPI
JCDBG17129JCDBG07173PPI
JCDBG17129JCDBG06075PPI
JCDBG17129JCDBG18419PPI
JCDBG17129JCDBG20886PPI
JCDBG09164JCDBG07506PPI
JCDBG09164JCDBG04400PPI
JCDBG09164JCDBG15223PPI
JCDBG09164JCDBG07173PPI
JCDBG09164JCDBG09698PPI
JCDBG06148JCDBG07506PPI
JCDBG06148JCDBG15223PPI
JCDBG06148JCDBG17821PPI
JCDBG06148JCDBG12398PPI
JCDBG06148JCDBG06075PPI
JCDBG18679JCDBG03609PPI
JCDBG00558JCDBG07506PPI
JCDBG00558JCDBG04400PPI
JCDBG00558JCDBG15223PPI
JCDBG00558JCDBG08109PPI
JCDBG00558JCDBG06075PPI
JCDBG07506JCDBG12398PPI
JCDBG07506JCDBG08310PPI
JCDBG04400JCDBG09074PPI
JCDBG04400JCDBG08310PPI
JCDBG04400JCDBG22117PPI
JCDBG15223JCDBG12398PPI
JCDBG15223JCDBG08310PPI
JCDBG17821JCDBG06075PPI
JCDBG17821JCDBG20116PPI
JCDBG07173JCDBG12398PPI
JCDBG07173JCDBG08310PPI
JCDBG12398JCDBG08109PPI
JCDBG12398JCDBG08310PPI
JCDBG08109JCDBG08310PPI
JCDBG08109JCDBG22117PPI
JCDBG06075JCDBG20116PPI
JCDBR00073
ID
JCDBR00073
Name
rpoA
Type
protein_coding
Scaffold
NC_012224.1
Start
84516
End
85535
Strand
-
Exon
84516-85535
Sequence
TATGGTTCGAGAGAAAGTAACAATATCTACTCGGACACTGCAGTGGAAATGTGTTGAATCAAGAACGGACAATAAACGTC TTTATTATGGACGCTTTATTCTATCTCCACTTATGAAAGGCCAAGCTGACACAATAGGCATTGCGATGCGAAGAGCTTTG CTTGGAGAAATAGAAGGAACATGTATCACACGTGCAAAATCTGAGAAAATACCACACGAATTTTCTACTATAGCAGGTAT TCAAGAATCAATACATGAAATTTTAATGAATTTGAAAAATGTTGTATTGAAAAGCAATTTGTATGGAACTTGTGACGCGT CTATTTATGTCAAAGGTCCTGGATATGTAACTGCCCAAGACATCATCTTACCGCCTTTTGTGGAAATTATTGATAATACA CAGCATATCGCTAGCCTAACGGAATCAATTGATTTGTGTATTGGATTACAAATCGAGAGGAATCGCGGCTATCGTATAAA ACCGACAAATAACTTTCAGGACGGAAGTTATCCTATAGATGCTGTATTCATGCCTGTTCGAAATGCGAATCATAGTGTTC ATTCTTATGGAAATGGAAATGAAAAGCAAGAGATACTTTTTCTCGAAATATGGACAAACGGAAGTTTAACTCCTAAAGAA GCACTTCATGAAGCCTCCCGAAATTTGATTGATTTATTTATTCCTTTTCTACATGCAGAAGAAGAAAACTTACATTTAGA AATAAATCAACACAAGGTTACTTTACCCCTTTTTACTTTTCATGGTAGATTGACTAAATTAAGAAAAAATCAAAAAGAAA TAGCATTGAAATACATTTTTATTGACCAATCAGAATTGACCCCTAAGACCTATAATTGCCTCAAAAGGTCCAATATACAT ACATTATCGGACCTTTTAAATAAGAGTCAAGAAGATCTTATGAAAATTGAAAATTTTCGCATAGACGATGTAAAACATAT ATTGGGTATTCTAGAAATAGAAAAACATTTCGCAATTGATTTACCAAAGAATAAAATATA
Product
Source
RefSeq
Link:
JCDBP00051
ID
JCDBP00051
Parent
JCDBR00073
Name
YP_002720144.1
Scaffold
NC_012224.1
CDS
84516-85535
Strand:
-
Sequence
MVREKVTISTRTLQWKCVESRTDNKRLYYGRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRAKSEKIPHEFSTIAGI QESIHEILMNLKNVVLKSNLYGTCDASIYVKGPGYVTAQDIILPPFVEIIDNTQHIASLTESIDLCIGLQIERNRGYRIK PTNNFQDGSYPIDAVFMPVRNANHSVHSYGNGNEKQEILFLEIWTNGSLTPKEALHEASRNLIDLFIPFLHAEEENLHLE INQHKVTLPLFTFHGRLTKLRKNQKEIALKYIFIDQSELTPKTYNCLKRSNIHTLSDLLNKSQEDLMKIENFRIDDVKHI LGILEIEKHFAIDLPKNKI
Product
RNA polymerase alpha subunit
Source
RefSeq
Link
YP_002720144.1
InterProScan
IPR009025 DNA-directed RNA polymerase, RBP11-like dimerisation domain
IPR011260 RNA polymerase, alpha subunit, C-terminal
IPR011262 DNA-directed RNA polymerase, insert domain
IPR011263 DNA-directed RNA polymerase, RpoA/D/Rpb3-type
IPR011773 DNA-directed RNA polymerase, alpha subunit
Pfam
PF01193.20 RNA_pol_L Domain
PF01000.22 RNA_pol_A_bac Domain
PF03118.11 RNA_pol_A_CTD Domain