Detail information of JCDBG00074

JCDBG00074
ID
JCDBG00074
Name
rps11
Type
protein_coding
Scaffold
NC_012224.1
Start
85598
End
86014
Strand
-
Link
Genbank id:7564767
Molecular function
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0005622 | intracellular
Biological process
GO:0006412 | translation
KEGG
Entry: K02948
Name: RP-S11, MRPS11, rpsK
Definition: small subunit ribosomal protein S11
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
TATGGCAAAACCTTTACCAAGAATTGGTTCACGCAGAAATGGGCGTGTTGGCTCACGTAAGAATGCGCGTAAAATACCAA AAGGGGTTATTCATGTTCAAGCAAGTTTCAACAACACTATTGTGACCGTTACAGACGTACGGGGTCGAGTAATTTCTTGG TCCTCCGCTGGCACTTGCGGATTCAGGGGCACAAGAAGAGGCACGCCATTTGCTGCTCAAACCGCAGCAGGCAATGCTAT TCGGACAGTAATGGATCAAGGTATGCAACAAGCAGAAGTGATGATAAAAGGCCCTGGTCTCGGACGAGATGCGGCATTAA GAGCTATTCGCAGAAGTGGTATACTATTAAGTTTCGTCCGGGATATAACCCCTATGCCACATAATGGCTGCAGGCCCCCT AAAAAAAGGCGTGTGTA
Gene structure

JCDB Genes gff download

JCDBG00074 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00074's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00074JCDBG00076co-exp0.954077
JCDBG00074JCDBG00073co-exp0.919097
JCDBG00074JCDBG00015co-exp0.915663
JCDBG00074JCDBG00014co-exp0.908064
JCDBG00074JCDBG00016co-exp0.898756
JCDBG00074JCDBG00017co-exp0.864342
JCDBG00074JCDBG00042co-exp0.855675
JCDBG00074JCDBG00066co-exp0.812118
JCDBG00074JCDBG00100co-exp0.80827
JCDBG00074JCDBG00122co-exp0.763418
JCDBG00076JCDBG00073co-exp0.907254
JCDBG00076JCDBG00015co-exp0.930852
JCDBG00076JCDBG00014co-exp0.927644
JCDBG00076JCDBG00016co-exp0.885852
JCDBG00076JCDBG00017co-exp0.827276
JCDBG00076JCDBG00042co-exp0.878569
JCDBG00076JCDBG00066co-exp0.790643
JCDBG00076JCDBG00100co-exp0.852873
JCDBG00076JCDBG00122co-exp0.687073
JCDBG00073JCDBG00015co-exp0.832888
JCDBG00073JCDBG00014co-exp0.847308
JCDBG00073JCDBG00016co-exp0.842042
JCDBG00073JCDBG00017co-exp0.843437
JCDBG00073JCDBG00042co-exp0.877775
JCDBG00073JCDBG00066co-exp0.745586
JCDBG00073JCDBG00100co-exp0.863882
JCDBG00073JCDBG00122co-exp0.764449
JCDBG00015JCDBG00014co-exp0.962428
JCDBG00015JCDBG00016co-exp0.940419
JCDBG00015JCDBG00017co-exp0.837062
JCDBG00015JCDBG00042co-exp0.895991
JCDBG00015JCDBG00066co-exp0.817076
JCDBG00015JCDBG00100co-exp0.823086
JCDBG00015JCDBG00122co-exp0.616083
JCDBG00014JCDBG00016co-exp0.880861
JCDBG00014JCDBG00017co-exp0.844381
JCDBG00014JCDBG00042co-exp0.895739
JCDBG00014JCDBG00066co-exp0.856988
JCDBG00014JCDBG00100co-exp0.790546
JCDBG00014JCDBG00122co-exp0.645464
JCDBG00016JCDBG00017co-exp0.87755
JCDBG00016JCDBG00042co-exp0.87673
JCDBG00016JCDBG00066co-exp0.814743
JCDBG00016JCDBG00100co-exp0.848717
JCDBG00016JCDBG00122co-exp0.687024
JCDBG00017JCDBG00042co-exp0.821724
JCDBG00017JCDBG00066co-exp0.924073
JCDBG00017JCDBG00100co-exp0.742444
JCDBG00017JCDBG00122co-exp0.805024
JCDBG00042JCDBG00066co-exp0.761356
JCDBG00042JCDBG00100co-exp0.91609
JCDBG00042JCDBG00122co-exp0.644414
JCDBG00066JCDBG00100co-exp0.635237
JCDBG00066JCDBG00122co-exp0.749835
PPI network
node1node2type
JCDBG00074JCDBG09324PPI
JCDBG00074JCDBG15890PPI
JCDBG00074JCDBG14958PPI
JCDBG00074JCDBG17434PPI
JCDBG00074JCDBG23530PPI
JCDBG00074JCDBG09611PPI
JCDBG00074JCDBG23880PPI
JCDBG00074JCDBG08468PPI
JCDBG00074JCDBG03587PPI
JCDBG09324JCDBG14958PPI
JCDBG09324JCDBG23880PPI
JCDBG14958JCDBG23880PPI
JCDBG17434JCDBG23530PPI
JCDBG17434JCDBG23880PPI
JCDBG23530JCDBG23880PPI
JCDBG23530JCDBG03587PPI
JCDBG09611JCDBG23880PPI
JCDBG23880JCDBG08468PPI
JCDBG23880JCDBG03587PPI
JCDBG08468JCDBG03587PPI
JCDBR00074
ID
JCDBR00074
Name
rps11
Type
protein_coding
Scaffold
NC_012224.1
Start
85598
End
86014
Strand
-
Exon
85598-86014
Sequence
TATGGCAAAACCTTTACCAAGAATTGGTTCACGCAGAAATGGGCGTGTTGGCTCACGTAAGAATGCGCGTAAAATACCAA AAGGGGTTATTCATGTTCAAGCAAGTTTCAACAACACTATTGTGACCGTTACAGACGTACGGGGTCGAGTAATTTCTTGG TCCTCCGCTGGCACTTGCGGATTCAGGGGCACAAGAAGAGGCACGCCATTTGCTGCTCAAACCGCAGCAGGCAATGCTAT TCGGACAGTAATGGATCAAGGTATGCAACAAGCAGAAGTGATGATAAAAGGCCCTGGTCTCGGACGAGATGCGGCATTAA GAGCTATTCGCAGAAGTGGTATACTATTAAGTTTCGTCCGGGATATAACCCCTATGCCACATAATGGCTGCAGGCCCCCT AAAAAAAGGCGTGTGTA
Product
Source
RefSeq
Link:
JCDBP00052
ID
JCDBP00052
Parent
JCDBR00074
Name
YP_002720145.1
Scaffold
NC_012224.1
CDS
85598-86014
Strand:
-
Sequence
MAKPLPRIGSRRNGRVGSRKNARKIPKGVIHVQASFNNTIVTVTDVRGRVISWSSAGTCGFRGTRRGTPFAAQTAAGNAI RTVMDQGMQQAEVMIKGPGLGRDAALRAIRRSGILLSFVRDITPMPHNGCRPPKKRRV
Product
ribosomal protein S11
Source
RefSeq
Link
YP_002720145.1
InterProScan
IPR001971 Ribosomal protein S11
IPR018102 Ribosomal S11, conserved site
IPR019981 Ribosomal protein S11, bacterial-type
Pfam
PF00411.15 Ribosomal_S11 Family