Detail information of JCDBG00075

JCDBG00075
ID
JCDBG00075
Name
rpl36
Type
protein_coding
Scaffold
NC_012224.1
Start
86130
End
86243
Strand
-
Link
Genbank id:7564768
Molecular function
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0005622 | intracellular
Biological process
GO:0006412 | translation
KEGG
Source
RefSeq
TF
Description
Sequence
TATGAAAATAAGAGCTTCTGTTCGTAAAATTTGTGAAAAATGTCGACTGATACGTAGACGGGGACGAATTATAGTAATTT GCTTCAACCCAAGACATAAACAAAGACAAGGATA
Gene structure

JCDB Genes gff download

JCDBG00075 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00075's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00075JCDBG00063co-exp0.953019
JCDBG00075JCDBG11239co-exp0.952265
JCDBG00075JCDBG18716co-exp0.940498
JCDBG00075JCDBG00037co-exp0.939222
JCDBG00075JCDBG10025co-exp0.937833
JCDBG00075JCDBG13429co-exp0.933587
JCDBG00075JCDBG00112co-exp0.92744
JCDBG00075JCDBG00584co-exp0.921268
JCDBG00075JCDBG00065co-exp0.920844
JCDBG00075JCDBG03063co-exp0.920301
JCDBG00063JCDBG11239co-exp0.950032
JCDBG00063JCDBG18716co-exp0.890779
JCDBG00063JCDBG00037co-exp0.966339
JCDBG00063JCDBG10025co-exp0.872498
JCDBG00063JCDBG13429co-exp0.909565
JCDBG00063JCDBG00112co-exp0.929563
JCDBG00063JCDBG00584co-exp0.917572
JCDBG00063JCDBG00065co-exp0.942622
JCDBG00063JCDBG03063co-exp0.941958
JCDBG11239JCDBG18716co-exp0.925374
JCDBG11239JCDBG00037co-exp0.943379
JCDBG11239JCDBG10025co-exp0.921294
JCDBG11239JCDBG13429co-exp0.923671
JCDBG11239JCDBG00112co-exp0.919971
JCDBG11239JCDBG00584co-exp0.946748
JCDBG11239JCDBG00065co-exp0.91345
JCDBG11239JCDBG03063co-exp0.947547
JCDBG18716JCDBG00037co-exp0.885156
JCDBG18716JCDBG10025co-exp0.945918
JCDBG18716JCDBG13429co-exp0.894017
JCDBG18716JCDBG00112co-exp0.874521
JCDBG18716JCDBG00584co-exp0.905048
JCDBG18716JCDBG00065co-exp0.886142
JCDBG18716JCDBG03063co-exp0.85753
JCDBG00037JCDBG10025co-exp0.874505
JCDBG00037JCDBG13429co-exp0.887161
JCDBG00037JCDBG00112co-exp0.958141
JCDBG00037JCDBG00584co-exp0.913158
JCDBG00037JCDBG00065co-exp0.962165
JCDBG00037JCDBG03063co-exp0.928898
JCDBG10025JCDBG13429co-exp0.879446
JCDBG10025JCDBG00112co-exp0.871756
JCDBG10025JCDBG00584co-exp0.898352
JCDBG10025JCDBG00065co-exp0.867616
JCDBG10025JCDBG03063co-exp0.851068
JCDBG13429JCDBG00112co-exp0.883533
JCDBG13429JCDBG00584co-exp0.886578
JCDBG13429JCDBG00065co-exp0.871602
JCDBG13429JCDBG03063co-exp0.894179
JCDBG00112JCDBG00584co-exp0.882179
JCDBG00112JCDBG00065co-exp0.944148
JCDBG00112JCDBG03063co-exp0.896028
JCDBG00584JCDBG00065co-exp0.86743
JCDBG00584JCDBG03063co-exp0.912998
JCDBG00065JCDBG03063co-exp0.877953
PPI network
node1node2type
JCDBR00075
ID
JCDBR00075
Name
rpl36
Type
protein_coding
Scaffold
NC_012224.1
Start
86130
End
86243
Strand
-
Exon
86130-86243
Sequence
TATGAAAATAAGAGCTTCTGTTCGTAAAATTTGTGAAAAATGTCGACTGATACGTAGACGGGGACGAATTATAGTAATTT GCTTCAACCCAAGACATAAACAAAGACAAGGATA
Product
Source
RefSeq
Link:
JCDBP00053
ID
JCDBP00053
Parent
JCDBR00075
Name
YP_002720146.1
Scaffold
NC_012224.1
CDS
86130-86243
Strand:
-
Sequence
MKIRASVRKICEKCRLIRRRGRIIVICFNPRHKQRQG
Product
ribosomal protein L36
Source
RefSeq
Link
YP_002720146.1
InterProScan
IPR000473 Ribosomal protein L36
Pfam
PF00444.14 Ribosomal_L36 Domain